CAZyme Information: TRIVIDRAFT_147594-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_147594-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	ABDF02000005|CGC15	45708.63	4.7401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:3073978-3075839(+)

Full Sequence      

MNLTESYTNKLTHLTVRGGTVSFVDGCSGPAERALGIGRSFGAEWIRNAYHDMATADVFS
GTGGLDASIVFEMDRPENVGDAFQETLNIFKGSYNTRISMADLFAIATVMAVGACSNGKV
IVPFRGGRVDAVGPGPSGVPEPQQDLPTHTLSFAKQGFDTSEMIALVACGHSVGGVHGVD
FPEIVPNPIKNDNTVTFDTTTDNFDNFVLRMINTVPRDVKLTDIIEPLAIKPRKLSVAIN
DNGTLLASGIIRVSCGYPNCGPSYTYYRFNSIIPAELGISSFTVETVDTATGKATIHNNG
GAGFPMSDAILPMFGLSSQSRTTINGGAQLQLNLTVAVLNAEMFTNVSLIVPQPLNKSAP
ISPWNQEVVHMEPLYKISGTNFTLYRGIWQSSGPLTATSSHPFDIMAEGSTQTVSSLFNS
WDDVEFI

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_147594-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	43	205	1.4e-23	0.6078431372549019

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	7.00e-79	22	208	22	206	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	9.72e-29	39	212	15	193	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	3.37e-20	31	177	5	155	Peroxidase.
173825	ascorbate_peroxidase	9.35e-14	46	193	34	187	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173826	ligninase	4.94e-13	44	205	40	199	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ86986.1|AA0	1.01e-171	18	424	50	547
QYT03617.1|AA2	1.12e-157	35	427	61	549
UKZ67466.1|AA0	5.22e-85	22	188	54	220
QRW22025.1|AA2	1.42e-52	17	409	41	515
QGI68923.1|AA0	2.37e-52	43	374	64	464

PDB Hits     

TRIVIDRAFT_147594-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.60e-42	36	298	58	409	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	3.10e-11	46	187	118	259	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q7XZP5|APX5_ARATH	2.87e-10	33	194	21	184	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q42564|APX3_ARATH	2.62e-07	46	194	35	186	L-ascorbate peroxidase 3 OS=Arabidopsis thaliana OX=3702 GN=APX3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000072

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_147594-t45_1-p1.