CAZyme Information: TRIVIDRAFT_14657-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_14657-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	ABDF02000070|CGC1	47686.98	9.8737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000070:63081-64453(-)

Full Sequence      

MKPIPYHESRPLHSLIAVFAAWKGFLLAVALGTTVSHDYDTSTSLFFQSLYGSSANASAL
ATRLTRWDALYFMKAARDGYVYEQQWAFGAALPLSVRGILWLLKPLTQLVSDDAAALEPM
AAIAFTTFAHLLAVLALHRLTLVLFGNKSLAYVAAVLHILSPAGLFLSAPYGESPFACLS
FVGNLLFATGLRPGAGLFKRTLAFLGAGISFGLSTAFRSNGLISGLLFAVEATRCLLAFF
RQPSFSKLVLLASLIIGGLSIAAGSVVPQTVAWFRYCKVDLADTEPRPWCSRLVPSIYTF
VQEYYWNNGFLRYWTPNQLPLFILASPVLTFLIKSGVQVIRNLGQGLSKSTPVVPESLHT
FVLTLAVIQTVVAVLAITNFHVQIITRLASGYPVWYWWVANSLSNIETRKTGSMIVVFMV
MYAGIQGGLFASFMPPA

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_14657-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	437	4.4e-107	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.37e-37	39	437	27	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.55e-15	121	437	118	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53459.1|GT76	7.20e-314	1	437	1	437
QYT02819.1|GT76	2.44e-273	1	437	1	437
UKZ87563.1|GT76	2.81e-220	7	437	6	433
UKZ62611.1|GT76	1.32e-218	7	437	6	433
UNI18119.1|GT76	7.09e-166	1	437	1	434

PDB Hits     

TRIVIDRAFT_14657-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.00e-160	7	437	6	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.03e-120	8	437	15	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.24e-85	2	437	9	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	6.01e-78	7	437	25	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.24e-54	14	437	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999338	0.000687

TMHMM  Annotations     

Start	End
12	34
115	137
150	172
248	267
321	340
360	382
412	434