CAZyme Information: TRIVIDRAFT_144009-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_144009-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	ABDF02000003|CGC2	62055.98	4.9025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000003:2217372-2219633(+)

Full Sequence      

MSAKFDFVVVGAGPAGCLIASKLAASAARPTVALIEAGSESTASPLTAKRFQVLAESPEH
DYGYTTTTQSSLGGREITLNRGKGLGGSTLINFQVWQIGARDEFEEWARLVGDDDWKFDQ
VLKRLQQLEEYDDQVGPDWKTFNNPDPNTHGKSGVGPVEDESQWLIKAAIERGVWPELDN
HNKSFDLNNGDLIGWSFIASSTKDATRVTGATAFLANDQRPDNLTILTETRIVKIMFAGN
RAVGVVKEDGTKIEAIKEVVLCAGSIDSPRLLQLSGVGSQTDLDALGIPVVKNLQHVGKN
LSDHYVSFLSFSTKKEYSQRAYVERNFAQAAEQYAKDKTGPLAIYQASIPCGYMQDVPGF
DSPEFKCLLADARELLVKKTVPSYEIIVSRSIQSGPLVPPNYICQEDESYCTLFIVPTRP
QSTGSVKLASSNPKEAPLINPNYLDVPYDSVVLRNAIREGLALWKTETLKPFYVKDILAP
PSESDEDIDAYIRAAGGSLWHPCCTVRMGKSEQESCVDNNFRVHGLEGLRVADASVFPIL
PSGHTQAPAYLVGQYAFEKLSREYNL

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_144009-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	559	1.2e-142	0.9894366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.31e-99	1	563	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.60e-94	1	561	2	528	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.00e-46	420	556	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.55e-27	70	306	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.35e-22	5	563	56	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48406.1|AA3	0.0	1	566	1	564
QRC97674.1|AA3_2	1.70e-117	1	566	1	565
CAE7200393.1|AA3_2	1.94e-116	4	566	5	568
QDS74375.1|AA3_2	6.63e-116	4	566	10	568
ATZ54666.1|AA3_2	1.25e-115	4	566	8	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	3.84e-63	3	554	1	556	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	1.01e-62	5	554	2	555	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4HA6_A	4.36e-53	6	565	3	505	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	6.19e-53	6	565	19	521	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4H7U_A	8.39e-52	5	565	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C3K3D3|BETA_PSEFS	2.04e-60	1	560	1	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|V5NDL4|PDH1_AGACM	6.78e-60	5	565	37	595	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.97e-58	5	564	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q9WWW2|ALKJ_PSEPU	7.86e-58	5	566	2	533	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	1.46e-57	1	560	1	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000019

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_144009-t45_1-p1.