CAZyme Information: TRIVIDRAFT_135791-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_135791-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		38239.42	7.7186

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000090:1361722-1362977(-)

Full Sequence      

AAVANGHMQLQSPPPFRSKYNPNAGYDIDYSMTSPLDASGSDFPCKGYHKLLGTPAGKSV
ATWAPGGSYSFTITGTTANHGGGSCQASLSYDKGQTWKVIHSYIGACPPPDTSNWSFTVP
SDAPSGEAMFAWTWFNKIGNREMYMNCAAVTIGAGKKRAASTPFSSLPDIFVANVANNVC
TFEGKDVQFPNPGSIVDNKSQGTAPPGQSDCTGPAPASPPPVAPPAGDPDANTMKCSASP
SSQPPASQPAPTSAPMPTVPGGVFITSPIGQPTQAPTQPTTLVSVTSVSQPPAATSSGPQ
QTPSPPPPTNGGSKPPSGSTTAGTPCSAEGQWNCASDGKSFQRCASGAWSASIPVAPGTS
CQPGTSDNLTLVKKRS

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_135791-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	7	201	1.1e-68	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236776	PRK10856	0.007	241	331	168	253	cytoskeleton protein RodZ.
184923	PRK14959	0.008	202	321	377	495	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ51854.1|AA11	1.92e-223	1	376	15	411
UKZ77675.1|AA11	1.14e-194	1	376	15	383
QYS98861.1|AA11	4.41e-140	1	375	15	407
UKZ53236.1|AA11	3.55e-127	1	374	15	373
UKZ90028.1|AA11	3.45e-121	1	376	15	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	3.44e-34	7	197	1	200	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

TRIVIDRAFT_135791-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_135791-t45_1-p1.