CAZyme Information: TRIVIDRAFT_12934-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_12934-t45_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		55386.09	4.4027

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000091:1526011-1527871(+)

Full Sequence      

PTNAVNVWPDEATDELEKMLFEQQNPFESSLATFAVPCSASGLAIGRSFGAEWIRNAYHD
MATADVQAGTGGIDASIVFEKDRPENPGSAFQETLDFFRPRYTTRSSLSDLFAMAAVFGV
GGCSNGDIILPYRAGRVDATGPGPSGVPEPQEDLATHTAKFVKQGFNTIEMIAIVACGHT
VGGVHGVDFPEIVPNPQPPPPFGNDNSVFFDTSTSNFDNQVAKEFVANVSQNPLAFGHNN
ETMRSDFRIFNADGGDMISRMAESQEFFSQTCAALFERMINTVPPNVKLTDALQPLPVKP
RKWSIAVNDDKTLRLSLTLRVIDTLKGGSKGQISVSLLSRFGEPLPVATPLIIGNLSTST
CDYPNCGAEFFYYDFNTNIPAEQGISSFTVDIKDGTTEKITTFNNGGAVFPLSDAIQPQM
SLCNQTTTTINGVTLQQLGVTARVYNADQFTNISLIVPQPSNFSATISPWIPEVVPMRAS
SKIAGTNFTLYTGTWIASNEGAPQHPFDVVATGP

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_12934-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	51	280	7.4e-25	0.8901960784313725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	7.92e-102	8	281	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	1.26e-27	47	281	15	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	9.02e-16	47	185	13	155	Peroxidase.
173826	ligninase	3.80e-14	52	301	40	292	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	2.16e-09	54	185	34	168	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT03617.1|AA2	0.0	1	514	19	532
UKZ86986.1|AA0	2.01e-214	1	513	19	532
UKZ67466.1|AA0	9.57e-87	1	196	19	220
QRV79935.1|AA2	2.17e-77	8	495	22	495
QRW22025.1|AA2	6.45e-77	8	495	21	498

PDB Hits     

TRIVIDRAFT_12934-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	6.07e-60	8	400	23	406	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	1.03e-07	54	185	34	164	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q8GY91|APX6_ARATH	5.97e-07	54	182	118	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_12934-t45_1-p1.