CAZyme Information: TRIVIDRAFT_127900-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_127900-t45_1-p1
• CAZy Family: AA2
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	ABDF02000086|CGC3	42135.97	4.8407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000086:1209723-1210901(-)

Full Sequence      

AQGRHFCYVRPNTDGDDDAPAIMDALNNKCNSKSLVIFPGPVYNIQTNMTTLDLQDVVIY
QFGRMLWSTDINYWLSVSMPVGFQNQSTVWYFGGNNVIWDGWGVGTLDGNGQVWYDWAKS
QGNLAHRPMNINFRTLTNSVIRRLRFVQSQMWTMAITYSKHWSTLNTDGCDTIFSDSITF
RRWIVSNGDDAIALKMNSSNIAVYDSYFENGQGIAIGSMGQYNGKYEYLENFYAKNITLK
NTAHVSYLKTWAGISRGYPPNGGGGGYGVARNITIEDVKLIGGRQQPFFAWQCENYSGFA
GQDCDSSLFKMEDVAWRRVSGTVQSGVTEAAYFQCSAAAGGCDNFEVTDFDVTHAGSDEL
LAIWDCFNVNGPQGFACT

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_127900-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	74	370	3.5e-50	0.8338461538461538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.73e-18	92	377	48	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	2.80e-16	82	378	130	426	Probable polygalacturonase
177865	PLN02218	3.67e-14	17	336	82	393	polygalacturonase ADPG
178580	PLN03003	9.90e-12	103	376	119	382	Probable polygalacturonase At3g15720
215120	PLN02188	1.11e-11	16	352	50	374	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ52841.1|GH28	3.72e-291	1	378	44	436
QYT00033.1|GH28	1.59e-268	1	378	47	439
UKZ95914.1|GH28	5.24e-262	1	378	46	438
UKZ69522.1|GH28	2.27e-256	1	378	46	438
QPG94135.1|GH28	3.61e-199	1	378	47	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HG8_A	5.52e-07	94	356	68	335	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	3.52e-100	4	378	31	416	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	3.82e-66	2	378	27	436	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	3.82e-66	2	378	27	436	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	3.29e-64	7	357	32	418	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	3.29e-64	7	357	32	418	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_127900-t45_1-p1.