CAZyme Information: TRIVIDRAFT_112102-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_112102-t45_1-p1
• CAZy Family: AA14
• CAZyme Description: glycoside hydrolase family 55 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	ABDF02000085|CGC5	98919.25	4.3145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000085:1151198-1154378(+)

Full Sequence      

MALSRHKALILCTVFIYVMAVLGKASLVDTEQPVYFQHQRRALANPPIPASSQRLQNASS
VNAAENLVTAAIVKQGAYNKHRVANPRRNAYKSKTSSSAAHLIELDAQGPAAPNLTDELR
AAAALLAERDAAEQLANGTLHKSYAQFAKLPRPFLNIYNDDENKKSRSLLEDRATSNSSY
WVAQLSENGRPSMGYDTSYPVYRDVTNPMFGGGAKGDGVTDDTAAINAAIAYGGNCGENC
LSSSVKGTLIYFPPGTYLISTPINAYYYSQLVGDANDIPIIKTSASFIGLGAIQSDVYIP
NDNGNEWYVEQSNFYRQVRNFVIDISDTTTANAAGLHWQVGQATSVTNVAISASQASGDG
NTQMGMYTENGSGGFMSDVTIVGGAYGIYGGNQQYTVRNFQIIEQTTACICLIWDWGWTW
SGLYLSTAPIGISLINPQGSAGGGAITGSTYVMDSQFFDLTVGLDAAFNKTILESSIITL
DNIDLNAVQTVVTYANGDVLEGIPTTGIDFVVIGNVENDGSNFGQFEASVPDRPSGLVNS
VIYDRPLYYTKSRPQYETLSSSSIISVKDHGAVGDGVTDDTAAINSALALATTENLIYFP
AGSYIVTSTIIVPAHTRMTGSVWSQLVASGSYFADAASPKVMLQVGNSGDVGTVEISDML
FTSIGPLPGLILVEWNVQAASQGSVGIWDAHFRIGGAYGTKLQVAQCPASSPIQAGCIAA
AMMLHITPEANGYFENVWAWVADHDIDDAQNTQITVAVARGILIESSGPNWLYGTASEHS
ILYQYNFANTSNTFAGMIQTESPYYQFTEATESPGPFNSSVGMYSGDPIFPDSTCNGTAL
LCNFAWAVLMQGTTNLTIAGAGLYSWYDNYIETCVDTQNCQQRLVYDDGNNGGLHLWNLV
TIGSVEMISDYSGDAILAKPNTQAS

Enzyme Prediction     

No EC number prediction in TRIVIDRAFT_112102-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	173	918	7e-228	0.9689189189189189

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	2.33e-65	213	432	8	212	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.16e-12	564	620	1	60	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
314993	End_N_terminal	5.30e-04	572	608	1	37	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.
227721	Pgu1	0.002	213	258	89	125	Polygalacturonase [Carbohydrate transport and metabolism].
227721	Pgu1	0.004	557	604	75	124	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ56764.1|GH55	0.0	1	925	1	925
UKZ82498.1|GH55	0.0	1	925	1	854
BCS07544.1|GH55	0.0	31	924	32	909
BCR94970.1|GH55	0.0	31	924	32	909
QUC21841.1|GH55	2.81e-282	65	924	309	1073

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	2.33e-179	178	916	4	736	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	7.23e-153	166	909	12	732	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.15e-158	175	921	38	862	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	2.83e-145	153	890	21	743	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.01e-43	191	908	53	732	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999682	CS pos: 25-26. Pr: 0.9324

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_112102-t45_1-p1.