CAZyme Information: TRIVIDRAFT_112062-t45_1-p1

Basic Information

• Species: Trichoderma virens
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma virens
• CAZyme ID: TRIVIDRAFT_112062-t45_1-p1
• CAZy Family: AA11
• CAZyme Description: family 47 glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	ABDF02000005|CGC7	104703.78	5.0396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TvirensGv29-8	12405	413071	0	12405

• Gene Location: location=ABDF02000005:1147487-1150913(-)

Full Sequence      

MARRRYRLFMVCAVVILFLLYRVSQNTWEDPAHHASLYRPPTSNSPAAAGVESQPKPPPK
PAPEPENIPESKPKPQPDKPDDDDDGPGVKIPKLKELDDSKPQVNGKASAHADAESKPAN
NKIAPTNEDEEIEDIHQKNPPKNAPGVPADTRIHWRPVTEHFPVPTESIISLPTGKPQKV
PRVQHEFGVESPEAKSTRVRRQERVAKEIERAWSGYKKFAWMHDELSPVSAKHRDPFCGW
AATLVDSLDTLWIAGLKEEFDEAAKAVENIDFTTTPRSTIPVFETTIRYLGGLLGAFDVS
GGHDGGYPILLKKAVELADILMGIFDTPNRMPILYYQWQPEYASQPHRATSVGIAELGTL
SMEFTRLAQLTSDYKYYDAVDRITDALIELQKQGTSIPGLFPENLDVSGCNHTATADLRS
SLSQAAQKQMDQDLSEKPGNFIPGKGTKTEPHNAEKRPAQGTDSNDADENKSVEKPSQVP
SQQTARRGAPPFGADGFTANWDCVPQGLIISGYGFQQYHMGGGQDSAYEYFPKEYLLLGG
LESKYKKLYEDSVEAINEWLLYRPMTDGDWDILFPAKVQTAGNPTEDLMATFEVTHLTCF
IGGMYGLGGKIFGREKDLETAKRLTDGCVWAYQSTVSGIMPEGSEVLPCPTLEKCAFNQT
LWWEKLDPAKDWRDKQVAEWEEKKAAFDKQKGNKAQESKGDPRKTSDKDKETAGEALKET
AQDYGDSTGNSKAIHKRAVIPPPKSGDEEVGSELPQSLKDKIGLKGDEKKKPANSGVGIQ
REPGAPVDSVLEAKRLPPQEPKEQEIILPEKPQTHEEFVKQRIAELGLAPGFVHITSRQY
ILRPEAIESVWYMYRITGDPIWMEKGWKMFDATMNATRTEIANSAVDDVNSPEPGLKDEM
ESFWLAETLKYYYLLFSEPSVISLDEWVLNTEAHPFKRP

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	209	938	6.7e-171	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.54e-180	210	938	3	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.15e-83	118	939	13	519	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.002	186	401	375	582	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ49877.1|GH47	0.0	1	939	1	1121
UKZ76369.1|GH47	0.0	1	939	1	1121
QYS96046.1|GH47	0.0	1	939	1	1160
UKZ87138.1|GH47	0.0	1	939	1	1135
UKZ67291.1|GH47	0.0	1	939	1	1127

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	4.83e-36	205	935	9	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	8.25e-36	205	935	44	505	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	3.61e-31	201	401	5	198	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	3.78e-31	201	401	5	198	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	3.94e-31	201	401	10	203	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31723|MAN12_PENCI	4.24e-35	205	935	44	505	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q12563|MNS1B_ASPPH	1.91e-34	161	937	2	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A2QAS2|MNS1B_ASPNC	4.62e-34	212	937	53	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|E9CXX8|MNS1B_COCPS	1.21e-33	191	937	35	513	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	4.56e-33	187	937	25	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000015

TMHMM  Annotations     

There is no transmembrane helices in TRIVIDRAFT_112062-t45_1-p1.