CAZyme Information: TRIREDRAFT_80746-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_80746-t26_1-p1
• CAZy Family: GT48
• CAZyme Description: aryl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	GL985075|CGC1	64612.59	5.5969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985075:309856-311616(-)

Full Sequence      

MAITVPINSGDRFDFIVVGGGTAGNTVAGRLAENPNVRILVLEAGVANPEQLEEIMTPSN
AMNLRGSKHDWAYKTTIVKRDDYERIEKPNTRGKILGGSSSLNYFTWIPGCKATFDMWAE
YGGDEWTWDPLVPYLRKSVTYHDDEGLYDPDLAKIGSGGGPIHVSHAELLPELAPFRDAL
TKAWTSMGEPLTENIYDGDMLGLYHCADSIYKGQRSGSFLFLKNKPNITVVTGVHSKRLL
VDYADRVCRGVTVTQADGTELSFYADREVILSQGVYESPKLLMLSGIGPARELAKHNIDC
IVDSRHVGQNLIDHPAVPFVVRVKDGFGMDDVVLRKTAANAAARAAYARDHSGPLGSGFL
EMVGFPRIDRYLAKDPVYSKAVAANGGKDPLCPDGQPHFELDFVAMFGSAFQWHFPTPKE
GAHTTVVVDLVRPISKPGEVTLNSANHMDQPNINLNFFESELDIIAMREGIRFSYDLLTK
GEGFKDLVVDEYPWDMPLDDDAEMRRAVLDRCQTAFHPCGSARLGKTIEQGVVDPALKVH
GVKKLRVIDASIMPVIPDCRIQNSVYMVGEKGADLIKAEHKDLYLI

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_80746-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	578	8.7e-149	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.50e-85	12	577	5	532	choline dehydrogenase; Validated
225186	BetA	4.50e-83	8	581	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.46e-36	433	571	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.02e-24	13	569	56	569	Protein HOTHEAD
366272	GMC_oxred_N	4.34e-23	92	316	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT04257.1|AA3_2	0.0	1	584	1	583
UKZ95187.1|AA3_2	0.0	1	584	1	583
BCR85434.1|AA3_2	0.0	7	584	2	578
UKZ53071.1|AA3	0.0	7	584	3	579
UKZ78908.1|AA3_2	0.0	7	584	3	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	10	584	4	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	10	584	4	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	10	584	4	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.89e-70	13	579	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.02e-69	13	579	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.31e-59	14	580	15	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.91e-57	11	576	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q95NZ0|EO_SPOLI	7.16e-55	7	582	42	598	Ecdysone oxidase OS=Spodoptera littoralis OX=7109 PE=1 SV=1
sp|A0A3B1EFP9|STR4_STRTC	1.79e-54	13	577	36	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.25e-53	11	577	41	574	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999966	0.000069

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_80746-t26_1-p1.