CAZyme Information: TRIREDRAFT_80654-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_80654-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: glycosyltransferase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		97597.94	8.8889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985074:580777-583599(-)

Full Sequence      

MLLSRTRSNAAGHIAIDDGLKKQITSVGEDGRFELCFHDDAGSLATWCKNLQETSKRVQT
NPCSVPGICRRKSTGGFCPPLNIAILIVGSRGDVQPFIPIAQLLSKPPYGHRVRICTHPA
FKDFVESQGVEFFNIGGDPEALMSYMVRNPGLVPSRKSVRAGDIGKRRAEMWEIINRAWR
GCIEAGDGMGDPVRATDVENVEDLFLADAIIANPPSIAHIHCAEKLGVPLHMVFTMPFSP
TTAFPHPLASMNYSGADAKTANYLSFIMMELLMWQGLGDLINKFRRQKLGLDPISVMWGF
QLLSRLRVPFTYLWPESLIPKPPDWGKHIEVVGYSFLPLAKSYTPPPDLTAFLEKGPRPI
YIGFGSIVVEDPDAFSELLFKAVKIAGVRAIISRGWSGVGDKCRITEDVYLIDNCPHDWL
FQHVSAVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMIARSGAGPDPIPFKSLTAE
NLAESISVALTPSVQEAAKRMAEDIADENGAEAMAKSFQEQIGLDQFECEICPGRLATHR
HKKTGTRLSGLAVACLVDRGVIQPAELELIRRKNWYVDEGAEHPLVGLAAAFTGPMGDVA
TATFDYSHALRYRPKHTKVEDRRPSWIDPWATDNSTNGSVGSNVASPNRRINPTTFSTRE
MELYAHKIARRSLKTNNADIDTLIRQPSLYDKQKAAWHARERGRNGQLFYLTRATGRYAV
ELTKVGLKAPVAFFYNIANGFHNYPSCGYAGVEVRRRDQIIDFETGLVAAAKEFTLGIWD
AFSGVIILPYKSVHEEGAKGLGKGVWRGSKGFFSNLGASAFGLPGYALKGMEKELQKHHL
TNCKAEMILIRLRQGIEAFRRATPQERDEVVRRWKARGCTQKQS

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	193	517	6.4e-60	0.7696335078534031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.85e-69	81	520	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.58e-32	83	517	4	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	7.20e-16	83	245	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	3.26e-06	86	515	1	383	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ55778.1|GT1	0.0	1	884	1	885
UKZ81537.1|GT1	0.0	1	884	1	885
QYT00238.1|GT1	0.0	1	883	1	885
UKZ96015.1|GT1	0.0	1	874	1	881
UKZ71081.1|GT1	0.0	1	874	1	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.13e-77	82	560	21	474	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.93e-77	82	560	41	494	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	5.69e-33	81	522	1	381	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.20e-29	81	513	1	390	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.22e-29	81	526	1	403	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	2.78e-128	67	522	175	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	3.34e-126	79	522	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|P0CN90|ATG26_CRYNJ	1.15e-74	80	595	1033	1548	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|Q9Y751|ATG26_KOMPG	3.24e-74	82	522	762	1178	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	2.96e-73	80	595	1033	1548	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_80654-t26_1-p1.