CAZyme Information: TRIREDRAFT_80340-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_80340-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: glycosyltransferase family 32

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		37259.68	5.1347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985073:156191-157274(+)

Full Sequence      

MVWLSGRLTTHYYYNSSRQTWPDGYSFAGAGSGSLGQQQQQQQQQQSRVGSGAAGAQGRH
LIPPNIWQIVLPKAQPYRWDLKHVRIDPRQLENTASWLAMNPDWQYTLIGQRGGDDFVNS
HFGAGSRIAQAYHNLTNVGMKSDLLRYLVLGVQGGVYTDTDTVALKPVDAWIPQPVRDRA
RLVVGIEFDRRDGGPWADIPHWLQFCQWTIAAAPGHPVFGRMVDRVLRSLDDLSAAHGGV
SVEELRPESFEVMNSTGPAAWTDVVFEQLQEYNPLLNDTQDLSFMEEPTLIGDILILPID
GFGMGQDHSASTNDGSIPEAAMMRHLFTGSWRDE

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_80340-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	174	5.6e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.20e-22	62	333	82	346	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.00e-14	89	178	3	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ83874.1|GT32	7.24e-172	1	334	40	352
QYT06191.1|GT32	6.20e-166	1	334	40	352
UKZ94407.1|GT32	4.22e-162	1	334	41	354
UKZ58174.1|GT32	6.93e-162	1	318	40	336
UKZ69802.1|GT32	1.40e-160	1	334	41	353

PDB Hits     

TRIREDRAFT_80340-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.93e-45	79	334	147	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.01e-37	63	334	100	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.48e-26	62	334	96	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	8.34e-21	97	333	154	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999462	0.000570

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_80340-t26_1-p1.