CAZyme Information: TRIREDRAFT_79960-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_79960-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		67718.90	5.4195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985071:384566-386484(-)

Full Sequence      

MLVVGRPRLVRNSIILTLAILSIWHLGLLSRTPTSASALVSASVSASSEWSRLERLMNRG
APLTPYPDSNSSFDWSAIPFRYPPHNTTHLPPRHKQPPLPRIQHRFGPESPAAAKERIKR
LKAVKQVFLRAWQAYKGYAWKQDALLPISGGGREQFSGWAATLVDALDTLWIMGLREEFD
EAVAAVAEIDFGSSTSSRVNIFETNIRYLGGLLAAYDLSGREVLLKKAVELGDLIYAGFN
TENGMPVDFLNFYSAKSGEGLVVESSVVSASPGTLSLELAHLSQVTGDDKYYSAVSQVMD
VFYQGQNKTRLPGVWPIDVNMRAKDVVSGSRFTLGGCADSLYEYLPKMHQLLGGGEPKYE
TMSRTFLQAADRHFVFRPMLPGAEEDVLMPGNVNVDEDSGEAVLDPETEHLACFVGGMFG
LAGRLFSRPDDVETGVRLTNGCVYAYRAFPTGMMPERLDLAPCRDRSSRCPWDEEHWLEE
RAKRPEWEPHLPRGFTSAKDPRYLLRPEAIESVFYSYRITGRQEFQTAAWDMFTAVEKGT
RTQFANAAVLDVTRAADELPQEDYMESFWLAETLKYFYLMFTTPDIISLDDYVLNTEAHP
FKLVG

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	128	602	4.4e-151	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	127	603	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.87e-125	78	603	28	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT04436.1|GH47	0.0	5	603	4	587
UKZ82405.1|GH47	0.0	5	603	4	567
UKZ71903.1|GH47	0.0	5	605	4	590
UKZ95051.1|GH47	0.0	5	603	4	586
UKZ56672.1|GH47	0.0	5	603	4	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	4.67e-65	120	603	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	5.42e-65	120	603	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	5.70e-65	120	603	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	9.33e-65	54	603	23	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KKB_A	9.91e-65	111	604	14	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	3.43e-69	119	603	97	537	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|D4AV26|MNS1B_ARTBC	3.13e-68	97	603	20	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	3.82e-67	107	605	88	538	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	9.27e-66	110	605	187	646	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|Q9NR34|MA1C1_HUMAN	4.31e-63	124	603	178	617	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.827471	0.172544

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_79960-t26_1-p1.