CAZyme Information: TRIREDRAFT_79669-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_79669-t26_1-p1
• CAZy Family: GT35
• CAZyme Description: glycoside hydrolase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932	GL985069|CGC2	102105.20	6.9067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985069:708975-712247(-)

Full Sequence      

MANSIGGSSADKFDLDPLWQNLDWAIGQMMLMGWDGTQVTPQIRSLIEDHHLGSIILTAK
NLKSAHHTALLVQELQMIAKNSGHPQPLLIAVDQENGGVNSLFDEDFVCQFPSAMAIAAT
GSLELSYEVNKATATEISACGVNLMLGPVLDVLNNARYQVIGVRASGDDPQEVSQYGLAA
LSGIRDAGVASCGKHFPSYGNLDFLGSNLDVPIITQTLEELSLSALVPFRNAIASGKLDA
MFIGGCGISNPSMNVSHACLSDQVVDDLLRNELGFKGVAISECLEMEALSQDLGVQNGVV
MAVEAGCDIVLLCRAYDVQLEAIKGLKLGYENGIITKERIFTSLKRIFHLKSTCTSWAKA
LNPPGINLLSQIRPSHLALSRRAYDDSITIVRDKEKLLPLSLSMHPGEELLLLTPLVKPL
PASSLTKSLLESKNDPSLVSTEHDRWNHQIRERSAIMSGEGVFREFGKTLARYRNEKLLH
TSYTANGVRPVHENLINRASCIIIFTADANRNLYQAGFTKHVDMMCSMLRSRGQKKQLIV
VAVSSPYDFAMDKSIGTYICTYDFTENAMAALVRALVGDSNPVGTMPGTLRKSKKVLKSR
QHWLVEEFDSSRDRKGLNDLIRAVHRASDQDFRYLQTATADTFLLANQNIKETHFVVRNS
STQALYGFAATYFVQNVGILGALIVDPTKRNMSIGRSLHRRAIKSLTQQRGIKKVQLGSC
FPALFLGIPLDIEVTTTKEWFSNSGWDTQFPRRLTNMVIQDLSAWYAPEGLSQSIQRANI
SFDLIYGVESGDTVMHHVRTHANPEVLELYRTALEESKACGIVRAKDAAGNLLGTIIICR
PNSPLARYVPPLVSLGQDIGGLLAPIVPPAPLSTLVLQGLALMGVRQNKGHKATKSVLSW
VVDDAYEPLVAMGFDVLQAFEEITNSPETFQT

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_79669-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	311	4.4e-49	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.30e-70	26	406	7	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.54e-56	22	350	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.26e-39	36	327	10	294	beta-hexosaminidase; Provisional
185053	PRK15098	2.42e-09	22	320	47	328	beta-glucosidase BglX.
178629	PLN03080	6.97e-06	111	403	114	418	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGR47352.1|GH3	0.0	1	932	1	932
ACH72647.1|GH3	0.0	1	932	1	932
UKZ50159.1|GH3	0.0	1	932	1	932
UKZ76610.1|GH3	0.0	1	928	1	928
QYS95722.1|GH3	0.0	1	932	1	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	8.47e-95	21	838	8	769	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.75e-61	26	590	17	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.76e-43	21	587	43	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.95e-43	21	587	17	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.26e-43	21	587	47	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.94e-42	21	587	43	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	2.47e-32	36	330	12	300	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	5.49e-31	30	314	6	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	1.91e-30	29	329	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	3.50e-30	29	329	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_79669-t26_1-p1.