CAZyme Information: TRIREDRAFT_79606-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_79606-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984		112206.44	5.4757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985069:558341-561357(+)

Full Sequence      

MLEEKVVSFELGDGFSLIGAEIFVDDQDYTGVSIAANNLSTDFTRVTGRHCNPIVKARPS
APPARSCIVIGSLTQSPTIQLLRDQGKIDLTQIEGKWESWITTTVKEPFEGYDNALVIAG
SDKRGTIFGTYSLSEQIGVSPWHWWADVPPKKQQQIFALPVTTCNGEPSVKYRGIFINDE
CPGMDSWVHEKFGPKFDANFYHYVFELLLRLKANFMWPAMWRGYPYPGRSFFVDDPKNQE
LADTYGIVIGTSHHEPMQRAMNEWSTTQPEGTWNWDKNKEKITQYFEEGAERAVPYESYF
TMGMRGEGDVPMTGGDPVKILTEVLDVQRDIIKKNYGKEDGVLQLMALYKEVQGYYDKGL
AIPDDVTLLFGDDNFGNLRRLPTAEENKRSGGSGFYYHFQYTGYPRCYRWINSNTLGKAL
HQLQLAHYRGADRIWIFNVGDLKPVEIPMSFAFDLAWDINSITATTLPRYFEHLATREFG
EKYAGHIAKSWYDFNKLVALRKQDHIDASTFVIQKYHETDRILARWRQLLAETEAVYSHI
DEEHKSAFFQLVLHPVKASYIFTQVRVAQFTNQLFAKQRRNTTNVLLKKCISLMDADHDL
YEEYNSISDGKWNLMLRQPHYGYGDTGAEPSRNMIDGLCYVQTQEDSNPSVGHMGIAVEG
IEGINPGHINEDSDRTHPSRGGLEPGVTLPFITPYGEQTRYFEVFHRGTKEFSWEARPQY
KWIKLSQYEGHLNPRDDDIRVIITIDWAQVPADFDAKVMIEIIGTRDGYEQVHMTVRNSR
VPADFEGFVEESGHLAIDAGDWATAPYIQLPALGRPIAGAVTLPFDTDFSKPDELPFLRY
PIYVFSQHDNTNLELQFNTTLETEKTSRMQYDVRFDGGPIKTYRLTEDENNAENLPKGWP
TAVMDCVWKKGHNVGTVKKGSHTIEVRIRSQNVCLEKLLLDLGDLRYTYLGPPESEYVKK
GDTRSVGRGGVIGQLDSLKIDLGF

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	20	630	5e-227	0.8220946915351507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	0.0	166	505	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	6.55e-46	787	954	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
397627	Glyco_hydro_67N	0.002	32	133	33	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ50214.1|GH115	0.0	1	984	1	981
QYS95663.1|GH115	0.0	1	984	1	981
UKZ76661.1|GH115	0.0	1	964	1	963
UKZ86762.1|GH115	0.0	1	984	1	981
UKZ67706.1|GH115	0.0	1	984	1	981

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.02e-198	7	955	6	933	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.33e-144	3	623	32	647	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	4.71e-143	22	674	28	681	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.08e-139	22	674	27	680	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	6.43e-123	19	958	19	966	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

TRIREDRAFT_79606-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999612	0.000419

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_79606-t26_1-p1.