CAZyme Information: TRIREDRAFT_79602-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_79602-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: glycoside hydrolase family 81

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		79551.04	7.2920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985069:549661-552108(-)

Full Sequence      

MVSKDIFAEPIDVKLPPPQISTRKDHPVPRKGIAENAPLQTNKFYSNFFLEDQRCPTFTF
PYSLAWAGGKGTTASWGMACSHTEASQRVFGKEKFNGASSYYLNPVGIQSLVLSAKELGK
ETKLSIDSMTAFSARVHLSKDDASPPAISFPLVQGMAYITAQYSGATPVIQSGVFFKTMT
RVTRDLKRDLAKFTFHLEDGSTWLLYAWRTKGDPLDLKVTNNGLAESKQPFYGIIQVCKC
PRSQQSENILDDGAGIFPVSLELTGTARGYEGSYSFNFVIDGHQSGNLYMYALPHHVDSF
DQETSRRIQKETQLQSTTKGLATLVKGNRWTMVEPAMPVDMSFAPWDPEKGSIEKLSDHA
KSIIRSAAAKEVAQNMISQSNLDSMYFSGKALAKFATILYVIKDMLGDKALLQTGLGQLK
AAFATFAANEQKFPLVHETAWGGIVSSASYVTGNSGADFGNTYYNDHHFHYGYHILAGSM
IGYLDPDWLKQNKDYINILARDVANPSAKDKLFPMWRNFDWYHGHSWAHGLYAAMDGKDQ
ESSSEDMMHAYALKMWGKVSKNADLEARGNLQLSILARSLQNYYLYKNDNKVQPKQFIGN
KVAGILFENKVDHTTYFDPNIEAIQGIHMIPILPSTPFVRPKEFVQEEWDAFFSNGRIDD
IGNAWKGIIWASYASVEPKKAWEFFSSRSFSPQWLDGGASLTWFMAYSAGES

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	28	707	8.1e-219	0.9855305466237942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	355	705	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	6	710	54	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.02e-151	26	348	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ86758.1|GH81	0.0	1	709	1	709
UKZ76665.1|GH81	0.0	1	709	1	709
UKZ50218.1|GH81	0.0	1	709	1	718
QYS95658.1|GH81	0.0	1	709	12	720
UNI22551.1|GH81	0.0	1	709	1	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.38e-92	17	682	17	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.01e-92	17	682	42	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.39e-91	17	682	17	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.63e-23	316	681	282	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	6.60e-22	386	681	361	654	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	8.98e-231	1	711	188	902	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.12e-173	6	710	7	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.70e-157	3	712	72	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	7.18e-148	5	710	46	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.89e-146	17	710	411	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000018

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_79602-t26_1-p1.