CAZyme Information: TRIREDRAFT_76852-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_76852-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: glycoside hydrolase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		68493.94	5.5872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985061:985207-987542(-)

Full Sequence      

MHLFPAGLLALACVGTVFAQTGSPASYKVQKPPLDTDWTYKVGTDPWPEYPRPQLQREVW
QSLNGIWTFQPAGAGAGDSGSPPGGPLQREVLVPSCIESGLSGLQIMNITDMWFATSFKI
PHSWSGQAVILNFEAVDYEAVVFVNGAKVGSHTGGYFRFALDITNSVKFGEENDLTVFVH
DPTDLDVIPIGKQTRNPSHIFYRSCSGIWQSVWLESVPSNHITQLDVAAGMDGTVCVTVH
SSKKQGASAKVSVIGLDGRTIASHRGPSDEEFKFKVKHPKLWSPSSPTLYNLTVTLADDE
VSSYTGFRTVSSGKVKGIQRPLLNGEFTFMFGTLDQGFWPDGLYVPPNREALVYDLKMLK
GLGFNTVRKHIKVEPDLFYRACDEMGLMVIQDMPSLTNDGSRPPNPDQQAEFQRQLEVLV
NEHKNYPSIVTWVIYNEGWGQLRGPPYPEEKLVELVRSIDPTRLIDATTGWNDHGAGDFS
DNHHYANPQCGTPFYSTPSSPYDPSRIGFQGEFGGVGHNVSIEHLWNVQEAINTINQTYE
VDADLATYNYRAGVLFREFLEQVERYACSGGIWTQTTDVEGEVNGLYTYDRRVLRPDARQ
WKSDIKKLYSAAAGRR

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	55	503	2.2e-102	0.5146276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	3.71e-50	50	463	3	443	beta-D-glucuronidase; Provisional
225789	LacZ	7.85e-42	53	479	6	441	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	5.71e-25	107	479	88	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	1.36e-19	116	463	126	483	beta-galactosidase.
397120	Glyco_hydro_2_N	8.84e-17	61	218	2	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS93190.1|GH2	0.0	3	616	1	615
UKZ84644.1|GH2	0.0	1	616	1	616
UKZ74251.1|GH2	0.0	1	616	1	554
QLI73958.1|GH2	0.0	1	615	1	620
UKZ47694.1|GH2	0.0	112	616	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.67e-116	23	602	1	576	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	2.43e-35	62	465	22	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	7.17e-35	62	465	47	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6ECA_A	1.30e-33	61	466	41	462	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
3FN9_A	3.47e-32	121	474	71	439	Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	1.92e-31	113	437	106	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	1.01e-29	48	470	63	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P06760|BGLR_RAT	6.69e-28	50	465	29	475	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|O18835|BGLR_CANLF	6.78e-27	38	472	17	485	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P77989|BGAL_THEP3	2.57e-24	113	432	59	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999775	CS pos: 19-20. Pr: 0.9832

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_76852-t26_1-p1.