CAZyme Information: TRIREDRAFT_75421-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_75421-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773		88733.70	9.0539

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:1219219-1221683(-)

Full Sequence      

MARSPTPQGSLRQRNVASKQAPVESAFVPEVELDKLSKAALSSRRNIQRGELEHKLALTL
VTILGFVTRFWGISHPDEVVFDEVHFGKFASYYLQRTYFFDVHPPFAKLLFAFVGWLVGY
DGHFHFDNIGDSYVANKVPYVAFRALPAFLGALTVSVTYLIMWESGYSVPACLVATGLIL
LDNAHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHEPFSRKWWKWLILTGFALSCDIS
TKYVGLFAFVTIGSAVIIDLWDLLDIKRRYGAISMPEFGKHFAARAFGLIILPFLFYLFW
FQVHFSVLTRSGPGDDFMTPEFQETLSDNVMLASAVDIQYYDTITIRHKETKAYLHSHTD
TYPLRYDDGRISSQGQQVTGYPHNDTNNYWQILPADNDQKLGRNVKNQDLVRLRHIVTDK
ILLSHDVASPYYPTNQEFTCVTPEEAFGERQNDTLFEIRIEGGKTGQDFKTVASHFKLIH
FPSKVAMWTHTTPLPEWAYRQQEINGNKQITPSSNVWIAEDIPSLPEDDARRHKEQRKVK
SLPFLRKWFELQRSMFYHNNKLTSSHPYSSQPYHWPFLLRGVSFWTQNDTRQQIYFVGNP
IGWWLASSLLAVFAGIIGADQVSLRRGIDALDHRTRSRLYNSTGFFFLAWATHYFPFFLM
GRQLFLHHYLPAHLASCLVTGSLVEFIFNTDPADEEPSRSKNPKATGPRRHITARERFAG
KSMAGAWIACFVILAAAAASWYFFLPLTYGYPGLSVEEVLRRKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	61	305	3.9e-70	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	52	773	21	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.61e-83	60	309	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.65e-80	546	765	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	7.74e-18	356	504	13	170	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.06e-08	337	395	3	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP05785.1|GT39|2.4.1.109	0.0	1	773	1	773
AAR99494.1|GT39|2.4.1.109	0.0	1	773	1	773
QYT02404.1|GT39	0.0	1	773	1	771
UKZ53826.1|GT39	0.0	1	773	1	776
UKZ79621.1|GT39	0.0	1	773	1	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	9.98e-105	19	687	22	674	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	5.72e-89	8	672	20	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQQ_A	1.43e-06	353	504	32	183	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	3.12e-254	51	773	44	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	1.87e-244	51	773	49	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.91e-240	55	765	59	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1Q8R9|POMT2_DANRE	9.22e-111	58	687	71	691	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	2.14e-109	52	672	35	669	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000028

TMHMM  Annotations     

Start	End
56	73
98	120
141	163
191	213
243	262
282	301
595	617
637	659
723	745