CAZyme Information: TRIREDRAFT_74807-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_74807-t26_1-p1
• CAZy Family: GT21
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	GL985057|CGC8	44199.39	5.6152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985057:927129-928358(-)

Full Sequence      

MALPSWIWRHTLAYSAILSSLLHPTYAAPSTSLSATNYVANSVTAIRELNNAWYDVETGL
WNGAWWNSANAFTTLSDFALLRLDEANQLNVGGFLRNTYAQAQVVSVSVAKFVNSAGLPQ
TLHCINGRGCSASFAATLPTSLSKRGFANFIDEFYDDEGWWALALLHAHDATGDQDYLNS
AIEIFNDMQTGLGTPCGGIYWSKDRTYVNAIANELYLSVAASLANRVPSNATYLNIATAQ
WQFFKNSGMINSNNLINDGLDSNCKNNGLTTWSYNQGVILGGLSELYKATGDKSLLTTAS
AIANAAINALSDSNGILVEADKCELKPGNCGLDGQQFKGAFIRNLRYLNELAPSDTFRKF
ILRNAQSIWNNDRNSQNKLGPAWTGPYVAATGPSHSSALDALVAAIAVS

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_74807-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	391	3.6e-86	0.8938547486033519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.92e-29	149	370	80	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	9.03e-13	151	371	88	309	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
395616	Glyco_hydro_9	0.005	155	240	211	287	Glycosyl hydrolase family 9.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS93640.1|GH76	4.26e-265	1	409	174	583
UKZ47270.1|GH76	4.70e-262	1	409	174	583
UKZ73841.1|GH76	4.70e-262	1	409	174	583
UKZ85124.1|GH76	3.62e-244	1	409	193	599
UKZ60243.1|GH76	4.31e-244	1	409	189	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	1.77e-14	144	371	80	301	Chain A, Lin0763 protein [Listeria innocua]
4MU9_A	5.18e-09	154	385	116	340	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	1.33e-08	137	383	116	363	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
4V1S_A	3.09e-07	136	301	128	292	Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	1.70e-06	136	301	128	292	Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	6.55e-14	156	367	122	349	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000275	0.999700	CS pos: 27-28. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_74807-t26_1-p1.