CAZyme Information: TRIREDRAFT_73631-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_73631-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	GL985056|CGC7	60910.35	6.3364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985056:506653-508536(-)

Full Sequence      

MYAPPFVRAFGIAVLAVLPSFSSPATAASLKSSGSSSSCRCFPGDACWPSPADWKAFNQS
VGGRLIATVPLGSVCHGTTYDAARCADVKAAWPYADTHTDSSSSVLAPFFANQSCDPFLP
RETPCVIGTYVQYAVNVSSVADIQKTLAFSQKKNLRLVVRNTGHDYFGKSTGAGGLGLWM
HNLKTYDIHDYKSAAYTGKAVTMGAGIQAGESAATAFKQGLTIVSGICPTVGLAGGYTQG
GGLGPLTTRYGLGADQVLEWHAVLANGSEITATPTKNSDLYWALTGGGGGTYAVVYSMTV
KAHANEKTTGANLTFPNAGSEDVFFQGVQAFHDIIPAISDAGGTAVWTVLSKALSVGPVT
GPNMTKATMDSIFQPVLQKLDALNITYSYSSGEFSSFYESNAAYDPPVVSNGLQIGGRLV
KRSDFTGNPDGFIQAIRGIADQGGLVTGASYQLSSSLQHPPNSVNPELRKSLISFQIGVP
WINTDWATDLHNQDLITNSFVPALAALLPSGGSAYLNQADFREPGWQQVFYGENYEKLLE
LKDVYDPNGVFWGRTTVGSERWAETEDKRLCRVS

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	135	331	5.8e-47	0.4126637554585153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	4.81e-13	132	273	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	8.81e-13	111	551	19	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	2.58e-11	514	552	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.30e-57	39	572	500	1065
QKD57322.1|CBM91|GH43_11	1.30e-57	39	572	500	1065
CCA69005.1|AA7	3.18e-18	129	551	55	478
QRC92907.1|AA7	3.45e-18	139	559	71	492
QRW27390.1|AA7	1.09e-17	138	558	73	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.50e-127	36	573	25	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	5.05e-74	39	572	30	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	3.40e-22	138	551	55	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	4.54e-22	138	551	55	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
4PVK_A	6.58e-17	133	301	55	221	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G0R6T3|SORD_HYPJQ	0.0	1	574	1	574	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	2.07e-156	29	572	17	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A0A075TR33|PATO_PENEN	2.12e-149	32	574	21	568	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	2.48e-148	13	573	14	568	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	7.72e-127	36	573	25	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000503	0.999454	CS pos: 27-28. Pr: 0.9628

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_73631-t26_1-p1.