CAZyme Information: TRIREDRAFT_73256-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_73256-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 81

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		92096.19	6.4393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985062:884719-887934(-)

Full Sequence      

MLASLVNLVIASALGVAALPNGAKLSNIAGRGLFAPISTSNPAGISGGTTATGADGAPVS
SFFAGLKPPFPTNSWWASYAATPGNGTASGPFPYESQLDGLGINFGVSNSRQFDGTSIKQ
PTQNDWRAGFAEHSGAFANHKATAFDTHSVTVQYFQGGASMTSPLIPGSPYITLQYQAAT
PLLTSRNGGIASFNGQNLSNGQSVTATGTSFTVVDTTGTTYVIYALSSISLTATATNSAQ
GTIKATGTYNGVLRLVRLTQASHKALLDQHYTVYPTGVGLDYSFTTTTGTLIFNYNTVGD
GSQLLMLTWPHHRLSLQGANQPATSSLGYLTTKGWMYPIIGNQWKLLYQLSSITWNPPRA
LDSSCSSAVIQGLQYEIGLLANSTPPVPNEFYYWGGSLAAQARLALIAEAVGRTDLIPTV
TNYLKTSFQNWFTPSTGASPAYETSWGGVIDKAGATNSGIDFGNGYYNDHHFHYGYFLYV
AAVIAKYDANWLAQHKDFINWFARDIINPSPNDPYFPVTRCRDWFAGHSWASGIANGAGS
RDQESTGEAVNGYYGALLWATVALSQDYVNYARLLVATEQQGAQVYWHLYPQQSQTDPNN
PYPEPAVRNLVTMGNVEDWQSGAWLFWGNQKSEIAAIQMLPVTPINEVLYDAQWVNNVWS
YAQNEIVDPSIADDWRSVMIAAYSNANPQTAAAWSANLTTWGSGNTFSNELFFIGTRPNP
SGQPICGSNFPQNPYGNFKIQSATTGQWVVASTASSNLVASGSQASAGVFISSYTPNAGN
LKLTSNNQFVTADQSGNFALQAARATASSWEVFTIRQKVGAAAGVYTIKAGSNGKWVTLA
SDGSLINNGATEASAAGFKFVQS

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_73256-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	67	713	9.9e-123	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.28e-75	389	694	29	328	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.19e-69	1	691	16	725	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.72e-24	69	357	14	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS94990.1|GH81	0.0	1	863	1	863
UKZ93529.1|GH81	0.0	1	863	1	863
UKZ70759.1|GH81	0.0	1	863	1	863
UKZ46054.1|GH81	0.0	1	863	1	862
UKZ72648.1|GH81	0.0	1	863	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	3.13e-54	19	718	19	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	1.47e-53	58	718	11	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	6.63e-53	58	718	11	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.96e-30	66	691	31	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.10e-20	377	641	344	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	1.00e-44	248	689	261	705	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	8.30e-44	266	691	244	672	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.46e-38	249	694	420	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.63e-37	259	679	639	1069	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.61e-31	293	689	341	746	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001419	0.998540	CS pos: 18-19. Pr: 0.9139

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_73256-t26_1-p1.