CAZyme Information: TRIREDRAFT_73016-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_73016-t26_1-p1
• CAZy Family: GT17
• CAZyme Description: aryl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	GL985060|CGC2	64611.59	6.0467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985060:376248-377987(-)

Full Sequence      

MAVRDGEHFDFIVVGGGTAGNCVAGRLAENPKVRILVIEAGVGNPQDHPEITTPANAMNL
RNSAHDWSYKSTLVKREDYERIEKPNTRGKALGGSSSLNYFTWVPGCKPTFDRWAEYGGK
EWTWDPLVHYLRKSATYHDDPKLYLPQLKKIGGGGPIHISHAELIEEMAPFRDNLQKAWI
SRGLPITENIYDGEMNGLYHCVDTIYKGVRSASWVFLKDKPNITILAETHAKKLLINYAD
RICRGVRVMTPDGKDLNVFADREVVLSEGVFESPKLLMLSGIGPARELAKFNIDVVVDSR
HVGQNLVDHPAVPFVLRVKEGIGMDSAVLRKGAENEKLQAKYNKDHSGPMGSGFLEMVAF
PRIDDYLEKDEAYRSAKEANGGLDPFSPEGQPHFELDFVCLWGSAFQWHFPFPREGEHTT
VVVDLVRPISDPGEVTLRSADALEQPGINLNFFANDLDIIAMREGIRFSYDVLTKGEGFK
DLVIAESPWEMPLGSDEEMKRAVLDRCQTAFHPVGTARLSKSIDQGVVDPSLKVHGVRNL
RVIDASVMPVIPDCRIQNSVYMVAEKGADMIKAEHRDIY

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_73016-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	573	1.9e-148	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.75e-85	7	572	4	532	choline dehydrogenase; Validated
225186	BetA	3.90e-81	2	576	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.32e-38	428	566	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.83e-22	88	311	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	9.91e-21	7	563	54	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53071.1|AA3	0.0	1	579	1	579
UKZ78908.1|AA3_2	0.0	1	579	1	579
QYT03200.1|AA3_2	0.0	3	579	18	594
UKZ97052.1|AA3	0.0	3	579	20	596
UKZ64141.1|AA3_2	0.0	3	579	7	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	5	579	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	5	579	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	5	579	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	6.43e-68	9	574	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.46e-67	9	574	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.20e-58	7	571	5	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.73e-58	7	572	41	574	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.38e-57	10	575	15	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	1.80e-57	7	572	44	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.13e-55	7	574	39	574	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000032

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_73016-t26_1-p1.