CAZyme Information: TRIREDRAFT_70910-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_70910-t26_1-p1
• CAZy Family: GH92
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		61505.26	6.1954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985099:23514-25335(+)

Full Sequence      

MTSYNYIIVGGGTAGLVLAARLTEDSSKRVLVLEAGEDLTGDARLSVPAMWPTLLNTDAD
WKFKTVPQPGLNNRAISFPQGKVLGGSSAINGLSFTHSSRANVDAWHKLGNPGWDWDSFS
RSLAKSYTLTSPSADVTGSGPLQLSYPKDTDNAWPSIWQQTLEGLGFPKSEETTRQACGP
LFVPDTIHPASKTRSYAGNAYLEPARSRDNLTVIPKAAVNRILFDKNGDAVTATGVEYIK
DGETQTATGKEIILTAGTINSPRLLELSGIGDAKRLEKLGINVVVNNPNVGENLQNHLMC
GLSFEAQDNEKTMDSLARQDPAALQAAMAAYAQQLGPFASSGTNNAAQLPFPGIKTAEGK
AELEELISKYITSANTGDNAAFVEAQANFVRSILTSPEEASGYYISFPGYAAFNPDGTMA
PPPAGNGKHFSIALLLAHPLSRGSVHITSATDVAIDPRYFSHPLDIEVLARHLGFVESIA
SAQPLASHLKAVEKRNTAVEQAKEYLRRTAVGAHHFTGTCSMMPEALGGVVDAQLRVYGV
PNLRVADASIIPLTPRANPQATVYGVAEHAAAIIKGDI

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_70910-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	576	3.3e-166	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.58e-87	1	576	3	533	choline dehydrogenase; Validated
225186	BetA	1.65e-86	3	578	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.08e-33	439	570	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.72e-27	2	563	54	565	Protein HOTHEAD
366272	GMC_oxred_N	1.14e-25	72	298	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS99722.1|AA3_2	0.0	1	578	1	595
UKZ52598.1|AA3_2	1.56e-314	1	578	1	593
UKZ90567.1|AA3_2	6.72e-312	1	578	1	596
AEO71939.1|AA3_2	1.62e-175	3	578	7	604
ANH22777.1|AA3_2	4.67e-161	4	578	6	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.88e-62	2	577	4	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	6.20e-62	4	574	36	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	1.84e-61	4	577	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.00e-61	4	577	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.66e-58	2	575	4	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	7.81e-85	2	577	12	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	7.81e-85	2	577	12	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.20e-82	2	578	38	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.64e-81	3	577	46	618	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.64e-81	3	577	46	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999936	0.000085

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_70910-t26_1-p1.