CAZyme Information: TRIREDRAFT_70373-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_70373-t26_1-p1
• CAZy Family: GH92
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	GL985090|CGC2	55239.36	7.7004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985090:114477-116813(+)

Full Sequence      

MGAAISILAVFPASASAGWQSFQPQRRTASSCPDYSSYSAQPHGPYSSGPLKLPYMRPSE
ECRTFKSPAVEKVISDLKSQLKDPDLARLFENTFPSTLDTTVKYFDPAQNLAFIITGFAH
LYKLLPHDKNLQALVKAVINTEARYISQYPYCGSFQPPPESGLAPSVNDWATGVRVNPPV
DNQTVFECKYELDSLAGFLKITRSYYANTKDSSFINDNWNAAMAQIVRVLFEQSQSSWSQ
DYQWVSYYNWTGTAGALSPMVPNSGNGEPKQANGLVASSHRPSDDLCVFNFITSDNAMMS
VELANVADMLGAIGTQRPLAKQLIQYSDTIKQAVWAHTRAANGIFAYETNGLGAQYIMDD
ANVPSLVSLPYLGFLKRSDPTYQKTKAAMFSRANPYYAAGKSFDGIGGPHVNATYPWPMS
QISAIFGTDSDREIKQRLALILGSTSGLGLIHESVSIYNGSSYTRPWFAWANSYFAEMIL
DLAERKPALILKSGRPYRIGQ

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_70373-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	83	480	1e-113	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	83	480	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.14e-114	62	493	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ55989.1|GH125	0.0	1	501	11	511
UKZ81730.1|GH125	0.0	1	501	11	524
QYT03629.1|GH125	0.0	1	501	11	524
UKZ89651.1|GH125	0.0	1	501	11	524
UKZ68238.1|GH125	0.0	1	501	11	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.36e-72	57	493	43	479	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.58e-72	57	493	23	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	2.67e-67	57	493	21	461	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	6.42e-55	70	481	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	3.39e-54	70	481	12	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	4.99e-123	32	494	27	508	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.120308	0.879672	CS pos: 17-18. Pr: 0.8317

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_70373-t26_1-p1.