CAZyme Information: TRIREDRAFT_69245-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_69245-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: glycoside hydrolase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938		104779.02	4.4125

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985083:386646-389732(-)

Full Sequence      

MGLILPGKKTRVGVALFVQLAAAAHNVIDLSQQQWTLTSPDYENITVAGKVPSHAHVDLY
EANIISDPYVMLNDFDLRWIGNSNWTYTSEIKGLYDHEDLASYLVFNGLDTYAAVEFCGQ
HIGNADNQFRQWVFDISEVLASCTSPQPQLAVKFGATPNISAAIAAEPGQETWPDGINEV
YEIPNRWFVRKEQSDFGWDWGPAFVPVGIWQPAYLVQLDGPGSVYVKNSAFDLYRKGQLN
NLPPDQAADWIFNASIDVVGTIPDEAQIRYTIVDSDSLEEVSSGSLSDVENAGDVITGLA
TLDPSQYELWWPSGLGAQKLYNVTVEVISNNKSIASVNKRMGFRTIVLNMEPISELELSQ
GIINGSNFHFEVNGHVFYAKGSNFVPPDPFWPRVTFEHIREILTDVVDANQNMLRVWSSG
AYSPDFMYDLADEMGILLWCEFQFSVSLYPVDPAFLENVRQEAVYQVRRANHHPSLALWA
GGNEMEKDELPAVKSRAPSQYERYLSEYLLLFLDTLLPTVYGNSHSISYMPCSTNNGYLE
LNFSLPIPFVDRLYNTTPGYLYGDSDFYDYDPSHAFDINKYVVGRFANEFGFPSMPSLET
WREAIPEDQLFFNSTMTVLRNHHYPPGSLTTNNTADPLRGMGEMTRGVQQWYPTPAKTDT
VANFAAWCHSTQVFQADFYHTKIQYYRAGSGMPQRQLGSLYWQLNDIWQAPTWSTREYDG
RWKVTFYATKDIFQPVIVAPVFNVTTGVLEIFAVSDLWSDVSGEASWEWIGYDGKPVGDP
EASVQSQKFTVGPVNSTVLSRINITQLTTSGGLPASNAILMANITATGTSPNTQGTKTYS
HSNYFTATPLSKAELIDPGLTIRHDGDAFTVTAEKGVSAFTWLALDPSDAGAIVTFDDNG
FWLRQGQSRTLGYRVHGESSGWESRVTVSSIWNNTLPS

Enzyme Prediction     

EC	3.2.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	795	1.5e-74	0.6888297872340425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.49e-48	27	741	12	637	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	3.05e-12	857	933	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
395572	Glyco_hydro_2	6.12e-07	245	344	13	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	2.08e-05	747	807	1	56	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	0.006	208	484	196	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ74844.1|GH2	0.0	14	938	14	956
QYS97815.1|GH2	0.0	14	938	14	937
UKZ48309.1|GH2	0.0	14	938	380	1300
UKZ67968.1|GH2	0.0	16	938	16	957
UKZ86527.1|GH2	0.0	1	938	1	957

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	0.0	13	937	16	942	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	3.38e-100	44	913	26	845	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
6BYE_A	8.04e-78	50	911	36	830	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	8.17e-78	50	911	36	830	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.20e-77	50	911	34	828	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NP78|MANBA_ASPFN	0.0	21	936	17	912	Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndA PE=3 SV=1
sp|B0Y7S2|MANBA_ASPFC	0.0	21	936	18	924	Beta-mannosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndA PE=3 SV=1
sp|Q2UN00|MANBA_ASPOR	0.0	21	936	17	912	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1
sp|Q4WMS9|MANBA_ASPFU	0.0	21	936	18	924	Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndA PE=3 SV=1
sp|Q0CI48|MANBA_ASPTN	0.0	6	935	4	929	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.475286	0.524717	CS pos: 23-24. Pr: 0.4984

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_69245-t26_1-p1.