CAZyme Information: TRIREDRAFT_68347-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_68347-t26_1-p1
• CAZy Family: GH75
• CAZyme Description: glycoside hydrolase family 18, chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	GL985079|CGC1	41889.39	4.1522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985079:377880-379149(-)

Full Sequence      

MLSRTLLTALGLTTIAAAAPSQTVKTRQAPGGQNAVYWGATNNENDNLSTYCTASSGIDI
VILSFLDIYGATGNFPSGNMGNSCYVGTNGVPQLCDDLASSIATCQAAGIKVIISLGGAA
SSYSLQSQSQAVAIGQYLWNAYGNSGNTTVQRPFGNVFVNGFDFDIELNAGSQYYQYLIS
TLRSNFANDPKNTYYITGAPQCPIPEPNMGEIISTSQFDYLWVQFYNNNPVCSLGLPGDA
PFNFNDWVSFISTTPSKNAKLFVGAPASTLGANGNAGGAKYYATPEQLAGIVNSVKSSPF
FGGIMLWDAGYSDSNVNNGCNYAQEAKNILLTGTACGGESSPPPSTTTTAVPPPASSTPS
NPSGGSVPQWGQCGGDGYTGPTQCVAPYKCVATSEWWSSCQ

Enzyme Prediction     

EC	3.2.1.14:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	34	322	3.3e-22	0.9628378378378378

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	2.98e-96	32	328	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	9.01e-13	35	284	3	239	Glycosyl hydrolases family 18.
395595	CBM_1	3.60e-10	369	397	1	29	Fungal cellulose binding domain.
197593	fCBD	6.37e-10	368	401	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
119350	GH18_chitinase_D-like	3.80e-07	37	318	6	308	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ56885.1|CBM1|GH18	1.14e-246	1	401	1	401
UKZ82618.1|CBM1|GH18	1.14e-246	1	401	1	401
QYT04674.1|CBM1|GH18	3.85e-238	1	401	1	401
UKZ86462.1|CBM1|GH18	6.15e-220	10	401	10	416
QYT01749.1|CBM1|GH18	7.54e-213	1	401	1	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	3.11e-57	35	331	4	308	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	3.20e-57	35	331	5	309	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	3.20e-57	35	331	5	309	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	1.72e-55	35	332	9	289	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	2.69e-45	32	308	1	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9F9R9|CHI2_METRA	5.58e-167	7	401	7	419	Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi2 PE=3 SV=2
sp|Q4U4T0|CHI2_METAN	5.25e-165	7	401	7	419	Endochitinase 2 OS=Metarhizium anisopliae OX=5530 GN=chi2 PE=1 SV=1
sp|A2QUQ2|CHIA1_ASPNC	4.51e-53	35	331	31	337	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|Q873Y0|CHIA1_ASPFM	1.30e-52	35	331	32	336	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|P29029|CHIT_YEAST	3.85e-52	35	332	30	310	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999683	CS pos: 27-28. Pr: 0.9495

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_68347-t26_1-p1.