CAZyme Information: TRIREDRAFT_67844-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_67844-t26_1-p1
• CAZy Family: GH74
• CAZyme Description: glycoside hydrolase family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	GL985078|CGC2	45351.61	4.9153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985078:95392-96773(+)

Full Sequence      

MAASVKNGASTIAYGLVKYYRGNETGQVPGILPEPYYWWESGALFNTLIDYWAQTGDDTY
NAVTKQGLLWQVGEGNNFMPVNQTASEANDDQGVWALAALSAAESGFPSPAADQPQWLDL
ARNVFDDFVARWDTKTCGGGLRWQIFTFNAGYDYKNSASSGVFFDLAARLYLQTKNSTYS
HWASEVFEWEHKVGLISDSYDVFDGVRTEACGTVDKIQNSMNAGIFLHGAAAMYNATSSS
EWKTRVDGLLKGVQSTFVKDGVLFEAACEGQGTCNVDMQAYKSFLARGLKATSELAPHTG
QTIRPLLLSSAKAAAAACAGTTTKMYLGKPNTVCGFSWIAKNGQVFDGKIGVGEQLNALS
AVISTISGGAAAGGDDGEGSSGGNGTSTAGPSKTSGTAGPVTASVKPPSAGTRVAANAVA
AVVVLGGVVVGLL

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	3	367	7.3e-99	0.9273743016759777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.35e-143	4	359	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48633.1|GH76	1.22e-212	3	433	25	449
UKZ75168.1|GH76	3.48e-212	3	433	25	449
QYS97446.1|GH76	5.12e-191	3	433	25	442
UKZ91066.1|GH76	1.48e-189	4	432	27	447
UKZ65660.1|GH76	5.26e-164	4	432	31	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.58e-105	9	366	40	403	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	1.12e-108	3	366	28	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.86e-102	4	365	31	384	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	5.21e-102	3	365	27	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.40e-95	4	362	31	383	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	8.17e-92	4	366	36	392	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000013

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_67844-t26_1-p1.