CAZyme Information: TRIREDRAFT_67600-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_67600-t26_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		68679.11	8.5030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985077:325089-326951(+)

Full Sequence      

SVIRNINGSFVPGTQTPQSQDSLGIVSASSFSSSIQQEEAKLRWDSDFELKKVSKSLLML
QKWLLIIGLLCINGLLIFLALRFHQLYYLFIVLLSSNTMLQALMMVAIIIMVTLRRCVPC
YFGRKEIIPEEPEKLVLLLPCYNETRDELTRSLDSLVDQKEIGAHPKVIFIVVDGNVRGP
NMEKTTQEYLLEDILGPGQYRHFENGYRARDGLFMPVKVQSGWYKGLPYVFVGKSYNQGK
RDSLCFARSFLYHFKQRSENVKTMFNNVLYEYIGSVFVQFGLDTVDFLVGMDADTVFDQF
CVIEMLHEIRSNPRLVGVCGHVCVDFDGKPFNPWSLYQSVEYSQTQGLRRMFQSRVTGKV
NCLPGCCQLIRVDESTFGDQVLRDRFGYCPKPNDVMTQHIMGNYSEDSIHASIIFSLFPK
KQTAQALRAKAFTIVPQNMKVFLSQRKRWALGSISNEFVMLFRPGIIFVERVQSFVAVVT
WAITPFIMAAVIELIRLFIKRGGTVFKDPVFVGLMSVLFARYFYSFCVGFWLPRNMMERA
QYFVGFFLHFLLSPFMNIIIMVYSLFNSDDFKWGKTREVVGEDDDAEKGALVNRAPVAH

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_67600-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	234	587	4.6e-32	0.6622390891840607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	6.11e-32	129	582	20	498	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	2.46e-27	138	456	2	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	7.23e-14	137	373	1	164	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.89e-11	286	580	139	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
184755	hmsR	5.89e-05	286	515	157	369	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ88757.1|GT2	0.0	1	594	67	660
UKZ51155.1|GT2	0.0	1	595	54	648
UKZ76986.1|GT2	0.0	1	595	54	648
UKZ63886.1|GT2	0.0	1	594	54	647
QYS98729.1|GT2	0.0	1	590	67	659

PDB Hits     

TRIREDRAFT_67600-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P9K9|CHS8_USTMA	1.18e-29	122	582	1254	1720	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|O13395|CHS6_USTMA	2.97e-29	129	582	402	862	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VNT4|CHS5_CRYNH	1.53e-28	129	582	1248	1708	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|J9VF17|CHS4_CRYNH	5.24e-27	129	582	501	961	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|J9VXM5|CHS3_CRYNH	2.80e-24	118	582	664	1165	Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999839	0.000155

TMHMM  Annotations     

Start	End
57	79
86	108
475	497
510	532
545	567