CAZyme Information: TRIREDRAFT_66792-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_66792-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: glycoside hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		35594.70	4.7822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985074:420225-421214(+)

Full Sequence      

MKLSTTIATGAALVAGVSAGQNNYLGFNSGNTLPDESAKFEKDFLAEFSTAQKLVGAPGT
FNAVRLYTNIQAYSKDTPIEAFSAAIKTKTYILLGVWASGTDNIDNELAALSAAVKQYGK
DLTDLIIGVSIGSEDLYRDSQTGRTNKAGVGNGPKEVLGFINDYKKTFANTALANVPIGH
VDTWDAWVNGTNKPVLDAVDWIGVDEYPFYETGKGNDISNAGKLFDTAFETTLGAANGKP
VWVTETGWPLTGPDWDEAKPSVKNAQKYWQDIGCKRLFNKYPTFWYNLRDSNPANQVKFG
ISQSLSSTPSFDLTCPKEETTTSAAKPTAT

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_66792-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.39e-20	1	274	24	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.16e-09	92	315	67	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00343.1|GH17	7.61e-215	1	328	1	330
UKZ81458.1|GH17	3.60e-213	1	318	1	318
UKZ55692.1|GH17	3.60e-213	1	318	1	318
UKZ71175.1|GH17	2.23e-202	1	330	1	332
UKZ95753.1|GH17	1.76e-201	1	330	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.06e-17	61	275	59	253	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.62e-16	61	275	59	253	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	9.93e-99	1	315	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.12e-98	1	315	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	4.48e-98	1	315	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.28e-97	1	330	1	328	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|A2QH21|EGLC_ASPNC	2.16e-95	11	320	7	315	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000518	0.999457	CS pos: 19-20. Pr: 0.9686

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_66792-t26_1-p1.