CAZyme Information: TRIREDRAFT_66789-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_66789-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: glycoside hydrolase family 75

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	GL985074|CGC5	26636.39	4.2597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985074:454519-455392(+)

Full Sequence      

MRSFDALLLAALAASPALARQIPSNVQSLYNFIRAQGQCKNILKGGFFSQEGDSKNFSYC
GDHLNDYRIMYLQGTNGNLVNMDIDCDGALGTGDGSCDSSQDTQSETSFKDTVASYKKGI
KDLNAYVHSFVVLGNEGSKSGYVNFDPQSVGVEPLSIVAVVCGNQMFYGVWGDTNGDDGP
PLVGEVSDSLGRACYGNAVNGNAAHDANDVLYIAFTGQDAVPGANGANWAASSFSAFESS
LGALGDKLVARIGS

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	8	251	1.1e-74	0.9863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	5.37e-80	82	251	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT00319.1|GH75	4.04e-169	1	254	1	254
UKZ55717.1|GH75	6.76e-167	1	254	1	254
UKZ71162.1|GH75	3.60e-161	1	254	1	254
UKZ95767.1|GH75	3.06e-160	1	254	1	254
UKZ81481.1|GH75	1.16e-147	1	254	1	238

PDB Hits     

TRIREDRAFT_66789-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	6.51e-60	17	252	16	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	2.40e-52	14	252	12	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	2.40e-52	14	252	12	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	1.24e-50	17	252	15	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	3.82e-50	8	252	6	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999723	CS pos: 19-20. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_66789-t26_1-p1.