CAZyme Information: TRIREDRAFT_66687-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_66687-t26_1-p1
• CAZy Family: GH67
• CAZyme Description: glycosyltransferase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	GL985074|CGC3	42812.50	7.2346

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985074:226345-227457(-)

Full Sequence      

MTSRAASLLFAAGLLSLSLWLLGQPLLVASPDRGRISNLDLVLGESLPAHLNLSSRFYAS
DQARAFCAAHGYRVFSPLARSGERKIYDLFMVNTELDWMEIRLETLYAHVDYFVIVESPK
TFQGSDKPLTVRDNWARFARFHDKMVYHQLVFPATFNPKRPWDYEDLQRDAMYDQVFPQL
EGRAAPEHGDVILVADVDEIPRPETLFLLRACSFPRRLTLASRFYYYSFQFLHSGPEWPH
PQATTYQGWRTVRPTNLRNGDGGIPFLRDLDKARLGNAAWHCSSCFATMEQFLNKMASFS
HVWMNQDEYRDRDNIAKAVREGKDVWGRDIDTFERIERNQDIPAVLRREGDKYRYLLDRS
GKSAGFTDYP

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_66687-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	65	358	2.1e-79	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	1.91e-47	67	357	61	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ81383.1|GT17	3.08e-245	1	370	1	372
UKZ55618.1|GT17	3.08e-245	1	370	1	372
QYT00425.1|GT17	9.15e-245	1	370	1	373
UKZ95673.1|GT17	8.42e-212	1	370	1	377
UKZ71249.1|GT17	5.20e-211	1	370	22	398

PDB Hits     

TRIREDRAFT_66687-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TRIREDRAFT_66687-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.057083	0.942908	CS pos: 29-30. Pr: 0.6787

TMHMM  Annotations     

Start	End
7	29