CAZyme Information: TRIREDRAFT_65817-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_65817-t26_1-p1
• CAZy Family: GH64
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	GL985072|CGC1	36472.47	5.0926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985072:427608-428585(-)

Full Sequence      

EIRYFFALDLRNCVTLLPRLIGSIIEAMQFLGPRSCALSIVEGDSPDGTGDVLAALRPSL
EALGVTYFFNSSTVRSAEGNRIAKLAALRNMPLEPIAQHTLALADDASVIFLNDVAACPE
DILELVLQRQRLGADMTCAMDWTYAGDDPTFYDVWIARGINGDSFFHIPASGSWAEAHRL
FWNAPAARARLERMRPFQAFACWNGATVFSARPIAEGLRFRTNHHKAGECFQGEPVLFCK
DMWWRGYGKIAVVPSVNLEYTNKNGKRIKELKGFVSDVVRAQHDDDDESEDRIDWAGPPD
TVLCMPTWKDQFFQRWNKSLTEGEM

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_65817-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	3	243	3.2e-68	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	9.25e-97	3	238	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ55420.1|GT69	4.60e-203	1	321	182	498
UKZ71485.1|GT69	9.31e-202	1	322	168	485
QYT00638.1|GT69	1.19e-201	1	322	185	502
UKZ95440.1|GT69	3.78e-201	1	322	168	485
UKZ81186.1|GT69	5.73e-173	43	321	184	458

PDB Hits     

TRIREDRAFT_65817-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	3.89e-46	3	306	128	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000043

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_65817-t26_1-p1.