CAZyme Information: TRIREDRAFT_65646-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_65646-t26_1-p1
• CAZy Family: GH64
• CAZyme Description: glycosyltransferase family 32

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	GL985071|CGC2	42228.64	4.6142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985071:733447-734633(+)

Full Sequence      

MLNPRRALIAAAFILTVFFLISRSHNSESASTSEPKDAEAEALSAANAQQRAAPPPPPQK
PMIDMSGMSTYDKLAYAYEYDIESKFPAYIWQTWRKTPSEGDFEFREQEASWSIEHPGFI
HEVITDSVADTLLQLLYGSIPEVLEAYHALPLPVLKADLFRYLILYARGGIYSDIDTYAI
RSALEWIPPQIPKETVGLVIGIEADPDRPDWADWYSRRIQFCQWTIQSKPGHPVLRDIIS
RITNQTLEMKKSGKLSAFQGNRVVDLTGPAVWTDTIMDYFNDERYFDMENSKGRIDYRNF
TGMETSKRVGDVVVLPITSFSPGVGQMGAKDYDDPMAFVKHDFEGTWKPESERHIGEIVQ
ELGEGQGEAPKEQ

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	107	188	3e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.78e-42	72	348	68	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.60e-19	111	188	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT04520.1|GT32	3.01e-237	1	373	1	373
UKZ82475.1|GT32	5.50e-234	1	373	1	358
UKZ56740.1|GT32	7.54e-222	59	373	23	336
UKZ94972.1|GT32	2.93e-220	1	363	1	369
UKZ71984.1|GT32	1.90e-212	1	364	1	371

PDB Hits     

TRIREDRAFT_65646-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.33e-91	73	348	86	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.09e-83	73	348	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	2.24e-66	72	348	116	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.10e-63	72	356	82	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.406448	0.593531	CS pos: 22-23. Pr: 0.4452

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_65646-t26_1-p1.