CAZyme Information: TRIREDRAFT_65275-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_65275-t26_1-p1
• CAZy Family: GH55
• CAZyme Description: Glucose/sorbosone dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		45403.97	4.0332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985071:112376-113814(-)

Full Sequence      

MARLAPHTLLLALFVFLFGSCTAQNCTTNNLQVTYPAPVAADGWEYRLISTGLTAPRSIV
FDSTGGLLVLDAGVGVRRLTLQDNGGTCLSVTANATLIADTALNHGLAISADGGTIYAST
VNDVYAYTYNEQTNTVDPTTRRTVVTNMTNTDHVTRTLLLSSRLPNELLVSRGSAANEDP
QARNVTSGHSQIRAYDISTLAATDPPFDFVAGTLIGWGLRDSVGVGENPTNGGIWSVENS
VDDLTREGVDVHQDNPGEELNFHGILGNTANQGGNYGYPDCYALWSTAGFPDLGALEVGD
QFASDNATAGVTDATCNTNFVDPRLVFQAHVSPLDIKFNTNGTTAYITFHGSSDIVSVAF
GLNGQPTSPMDSTTAANNILTSPDLTQCPDDCFTPVGLTFDTIGRLFFSSDSTGEIFVLQ
QSADDGNGDG

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_65275-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	34	419	2e-156	0.9800498753117207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.45e-18	36	367	49	356	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGR46829.1|AA12	3.99e-317	1	430	1	430
ETS00347.1|AA12	1.86e-312	1	430	1	438
QYT00796.1|AA12	2.11e-184	8	430	6	436
UKZ85601.1|AA12	1.29e-178	10	428	14	439
UKZ81042.1|AA12	1.10e-161	1	428	1	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1T_A	1.11e-290	26	422	1	405	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	2.52e-289	27	422	1	404	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1Q_A	1.40e-288	28	422	1	403	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	9.16e-66	41	421	18	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

TRIREDRAFT_65275-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000521	0.999450	CS pos: 23-24. Pr: 0.9022

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_65275-t26_1-p1.