CAZyme Information: TRIREDRAFT_65162-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_65162-t26_1-p1
• CAZy Family: GH55
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		37615.29	4.2689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985070:471437-472471(+)

Full Sequence      

MAVPVKELQLRAEPTDLPRLIVYFQTTHDSSNRPISMLPLITEKGIALTHLIVCSFHINQ
GGVVHLNDFPPDDPHFYTLWNETITMKQAGVKVMGMVGGAAPGSFNTQTLDSPDSATFEH
YYGQLRDAIVNFQLEGMDLDVEQPMSQQGIDRLIARLRADFGPDFLITLAPVASALEDSS
NLSGFSYTALQQTQGNDIDWYNTQFYSGFGSMADTSDYDRIVANGFAPAKVVAGQLTTPE
GAGWIPTSSLNNTIVSLVSEYGQIGGVMGWEYFNSLPGGTAEPWEWAQIVTEILRPGLVP
ELKITEDDAARLTGAYEESVKAAAADNKSFVKRPSINYYAMVNA

Enzyme Prediction     

EC	3.2.1.96:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	19	278	2.6e-18	0.6993243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	3.94e-144	19	275	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	5.29e-15	20	206	1	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119356	GH18_hevamine_XipI_class_III	9.68e-09	87	280	69	273	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
119350	GH18_chitinase_D-like	4.59e-08	86	270	69	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119361	GH18_narbonin	1.61e-07	125	270	105	248	Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function. Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity. Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination. This family also includes the VfNOD32 nodulin from Vicia faba.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL49862.1|GH18|3.2.1.96	4.75e-255	1	344	16	359
CAZ16624.1|GH18|3.2.1.96	4.75e-255	1	344	16	359
CAL49863.1|GH18|3.2.1.96	1.07e-251	1	344	16	359
QYS99830.1|GH18	2.48e-211	1	344	18	358
UKZ78493.1|GH18	5.60e-210	1	344	17	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AC1_X	5.94e-211	16	298	1	283	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2Y8V_A	5.12e-79	19	287	14	281	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
6K7Z_A	1.28e-15	86	294	65	278	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29026|CHI1_RHIOL	1.05e-07	90	271	110	293	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P29027|CHI2_RHIOL	2.49e-07	90	271	110	293	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000002

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_65162-t26_1-p1.