CAZyme Information: TRIREDRAFT_64925-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_64925-t26_1-p1
• CAZy Family: GH54|CBM42
• CAZyme Description: glycosyltransferase family 32

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		36893.46	5.3286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985070:542083-543159(+)

Full Sequence      

MLLLVDLSIVCLLVYTLEPLITLLRRNDELFNPRITIPRNATWGSSHFDNEVSHPRIPRI
LHQTTPNTTIPEKWAQSQRSCRETYADFEYMLWTDESARDFISTEYPWFVENWDGYAFPI
QRADAIRYFVLHHYGGIYLDMDTFCNETIPFEELEKGPGPHYALFKSTLPTGVTNDFMIT
TARHPAYAAAVSKLPLFYDITRFWAEIQPYANIMMSSGPLFLSLVVKDYLLGQPSLPSPT
VQVIDPPELGPYITDLESATWHKADAHALMWLGTRPWTWFLAGAIGLMAGLYLINYVLLL
VSDTFLRKVPSITYAIKESKLA

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_64925-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	149	3.1e-22	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.91e-42	53	281	78	299	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.63e-21	71	150	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ78464.1|GT32	1.95e-212	1	322	46	370
QYS99794.1|GT32	1.91e-208	1	322	47	372
UKZ96119.1|GT32	3.81e-199	1	322	42	363
UKZ69326.1|GT32	8.67e-197	1	322	37	358
ATY67327.1|GT32	4.07e-133	2	322	53	396

PDB Hits     

TRIREDRAFT_64925-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	5.27e-46	57	225	57	214	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	8.33e-46	57	267	62	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	5.15e-45	57	266	55	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.11e-45	50	271	74	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.07e-36	29	272	27	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987984	0.012037

TMHMM  Annotations     

Start	End
277	299