CAZyme Information: TRIREDRAFT_64543-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_64543-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: glycosyltransferase family 50

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	GL985069|CGC2	46874.42	9.9890

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985069:134534-135982(+)

Full Sequence      

MPPSLLTTLFRPAPLFSLAALLRLVLLLYGTWQDAHSAVKYTDIDYLVFTDAARSVSRGL
SPYARETYRYTPLLAWLLVPTASPRLFSFGKVVFALADLLAGWLIVRVLRKQRGMSAERA
GAFAAIWLWNPMVATISTRGSSEGLLGVLTMALLWAVEGRRIGVAGLILGLSVHFKIYPF
IYAPAIIWWMDDEHLGKKKTSKPPAALAEAVLRLVSPERIKLTLISLSTFMGLNVLMYYI
YGTPFLTHSYFHHVTRIDHRHNFSPYNIYLYLASANPSSSSLHAFLPQLLLSCLLIPFVL
AKKDLATSMMAQTFAFVTFNKVCTSQYFLWYMIFLPLYLPGSSMLRDPRRGITALLLWVL
GQAAWLQQGYELEFLGVSTFFPGLWLASLAFFLINCWILGIIISDGAERSIQKVHTS

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	403	8.7e-99	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	7.49e-84	29	403	25	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.60e-77	136	403	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	3.89e-07	59	242	47	229	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ48798.1|GT50	1.31e-269	1	415	1	414
QYS97269.1|GT50	2.95e-268	1	415	1	441
UKZ90890.1|GT50	5.94e-266	1	417	1	416
UKZ75326.1|GT50	3.62e-260	1	415	1	395
ATY62242.1|GT50	1.82e-222	6	415	17	439

PDB Hits     

TRIREDRAFT_64543-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	7.17e-206	11	413	9	415	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	1.47e-177	11	407	7	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q7S4Z3|GPI14_NEUCR	6.32e-177	4	408	17	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	1.12e-176	11	413	7	435	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	6.10e-172	12	405	8	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.413857	0.586132	CS pos: 37-38. Pr: 0.3827

TMHMM  Annotations     

Start	End
13	32
87	109
140	157
167	189
222	241
284	301
313	335
381	403