CAZyme Information: TRIREDRAFT_62424-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_62424-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: glycosyltransferase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1251	GL985065|CGC2	135180.38	5.6855

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985065:482576-486643(-)

Full Sequence      

MATPENQWNKPRRQPSSRPPPASEAVVTDGFVLPNLDVPADAPPAYGSHHDQLQFSRTGF
EAGAILTADGRVNININTKNQRLAELLGPSIASQIAAQPSLPPAYTLPSLAGEPGKEPPP
RLNVVIQIVGSRGDVQPFVALGQVLKDTYGHRIRIATHATFKTFVEENGLEFFNIGGDPA
ELMAFMVKHPGLMPGIDALKSGEIRRRRKGVQEMMLGCWRSCIEAGDGLGPPPEPHRRME
QWDPSAGMPGDPNHEPFVADAIIANPPSFAHIHIAEKLGIPLHMMFTMPWTPTRAFPHPL
ANIQSSNADDVLTNYLTYTLVEMMTWQGLGDIINRFRENALDLAPLSLIWAPGLLNRLKI
SYTYCWSPALIPKPNDWGPNIDVAGFYFLNLASSFTPEPDLAAFLEAGPPPVYIGFGSIV
VDDPNAMTRLILDAIHLAGVRALVSKGWGGLGIDAVGVPDGVFMLGNVPHDWLFERVSCV
VHHGGAGTTAAGIKAGKPTIVVPFFGDQPFWGAMIARAKAGPPPIPQKALTAEKLAEAIT
FCLQPDTQAQAQALGCKIREEKGTEAGSRSFHNHLNVDSLRCSVAPSRAAAWRLKRTKVR
LSPLAAAVLVQRRLIQYSDLKLYRPYEYNTEDQPPDPITAGACSLVTDISDIGMAIVDMP
LDILKSPRKAREAMGDAASQASGDDSDAASIPGSLKGRPGTKTPTAASAAETVGDASSVA
PLGHSPSLPAEIDRTRSPTAGSGGGSRSSSRRRALSATTMEAAVGTSRNVGRIVTTGVKS
PMNFCLGLAKGFRNIPRLYNDDTVRTVEKVTDFNSGVRVASKELGYGLYDGISGLVTQPM
RGAQKDGAAGLLKGFGKGVGGLIAKPAAGFWGLPAYVMQGAYAELNKFLSRSVQNYIITS
RVVQGERELQMASEGEKADIVNRWKHDAELGALYQRNAKGQERGHSRISSGDGSSFWRSP
LSEGRRQLGAALGDSKQQQPSRTMERSYSPVRKSADTASVADTEYEAAIRASVMETSRGD
VEEDAMIEAAIRESVKAMRQQGSLPDPVDLAATVKHHDLFEDEDYKITDEEYQNLIEQAL
RESLVGHAADPSVAQASSSNQELDAGKSAPPAYEGHTRSSGSAFTPMSDEDADLQRAIEE
SRRPPPTLPPRISPSQQVEDDEEEEQLRRAIEESKNEMERAQNKRTEEDIVLEYVKKQSL
AEEEYRKQHLAKGKGKEVADAADDDDEEELRRAIEESLRLSGEGSSAPPEA

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	231	569	7.1e-56	0.8036649214659686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.74e-75	122	574	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.10e-38	130	572	10	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.60e-18	124	297	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	8.05e-09	761	881	2296	2409	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
273616	MGT	6.35e-07	406	567	222	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS96614.1|GT1	0.0	1	1248	1	1253
UKZ90312.1|GT1	0.0	1	1248	1	1257
UKZ75890.1|GT1	0.0	183	1249	1	989
UNI23646.1|GT1	0.0	23	1248	34	1288
QLI68802.1|GT1	0.0	25	1249	38	1287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.90e-72	129	607	27	468	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.20e-72	129	607	47	488	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	8.64e-36	274	561	112	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	7.32e-29	122	566	1	373	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.66e-24	274	554	113	379	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.83e-125	120	575	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	7.16e-122	120	575	191	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	3.98e-73	122	575	1164	1609	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A1CFB3|ATG26_ASPCL	9.92e-73	117	575	903	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	1.13e-72	72	576	940	1414	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000001

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_62424-t26_1-p1.