CAZyme Information: TRIREDRAFT_62305-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_62305-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: glycosyltransferase family 24

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1487	GL985065|CGC5	165860.00	4.9584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985065:39083-43712(-)

Full Sequence      

MTQHRWWPWNLICALLLALQAHSTPTVNVGMIAAFPAGPYLLELLETAAAENSSSYFPLL
DRIAAGHFASASTDAALYAQVLDALQEDGSLSSPEALSTFKLALSLRSAAPRIEAHYQYY
ATAVASAVDDAAEPGCTNWVLLEGKQYCTPELDKVHREGLSSLRQAKDLPFDRTLGLGKE
AILYADPTSSSFGDFHEALSKAARQGSLTYRLRYRRSETTHASNLPISGYGVELALKRTD
YIVLDDRSHDEEAHADTLASATSLDDDEDVADIKPLASSDLSSLGLKAASFILQSDRPLD
TLIKLTQDLPRFLTSVVAHNISSQIEEELQSNGALGVPEGMNVLLVNGVQLIERQIEPFA
LIERLRQERKLIDGFRALGLSGKQAVSILGHQSVSLAKDSDEPLRYDWTDRLEDGRVLIW
LNDLENDDAYEHYPNSIASLLQRAYPGQLPPIAKNIFTLVAPVDFTSAEDVSFVAQLLSF
VSRGISVRFGLVPLTSTPEAAAKAKIAYHILENYGIRGLVSYLGRLQQAASTLSNEELFA
EITADHELLEDSEKMTLGEVLEADTYQQQLKLAQQWASRLKVDTPIRPTFFNGLSIPRDE
SWMQRLGMQIGEDLQTVQKGVFHGLLTDDDWAPGLFLSRAITRRNSYITPDDEKKSLRVL
NIDKVYKEHANLFEAVPVLEAAAESQREDWAVVTVIADLTTTSGKELLLSALEFKRRNPS
IRMDIVHNPLAATGAASANAALQASQGLLGDIQNIDELTNLLQTHSEDSINDGYFEALEQ
FLGASKIPSGARMIILNGRVIGPISEDSQFDADDFQQFLEVERMRRILPVYGAIEELGLS
DKLATPLDAARLTSITALSTISELPEGIFESTSSVRTTLYDKWQSTHTAIERGDEETASI
FIVGLLNPVSEQGQRWAPILKVLSELEGVHLKLFINPMSKVDELPVKRFFRYVLESQPSF
DEEGGVRGLVATFKNLPSEALLTAAVDVPPAWLVAPLISVHDLDNIKLSAVKTAVHATYV
LKHILIEGHSREGKGSAPRGAQLVLATEKDPLLTDTIVMSNLGFFQFKANPGVYSIRLKE
GRNTEVYEIESIGAQGWNPVAGDNGTDLALIDFQGVTLYPRLKRRAGMEMEDVLQEKGPS
NNIVAKGLKLAEGLFGGKSNKKSVSAQEHAEINIFSVASGHLYERMLNIMIVSVMRHTKH
TVKFWFIEQFLSPSFKEFIPRMAQEYGFKYEMVSYKWPHWLRQQKEKQREIWGYKILFLD
VLFPLSLDKVIFVDADQVVRTDMIELMNLDLEGAPYGFTPMCDSRTEMEGFRFWKQGYWA
NYLRGRPYHISALYVVDLRRFRELAAGDRLRQQYHSLSADPNSLANLDQDLPNHMQFHIP
IHSLPQEWLWCETWCSDESLSQARTIDLCNNPLTKEPKLDRARRQIPEWTAYDEEIAALR
QLFKQETGIAGKEKLADNGDSRAAESGAKNTKSRNLEGDRPHTKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1172	1419	3.3e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1172	1439	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1172	1419	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	4.29e-91	406	648	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	1.04e-64	661	857	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	4.32e-59	39	219	3	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS96472.1|GT24	0.0	1	1487	1	1482
UKZ49497.1|GT24	0.0	1	1487	1	1441
UKZ90174.1|GT24	0.0	1	1487	1	1487
UKZ64679.1|GT24	0.0	1	1487	1	1479
UKZ76027.1|GT24	0.0	1	1487	1	1376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	20	1484	4	1481	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	20	1484	4	1481	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	20	1484	4	1481	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	20	1484	4	1247	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	24	1381	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.40e-260	5	1461	2	1444	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	3.00e-234	16	1443	36	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q09332|UGGG_DROME	1.50e-233	91	1439	94	1507	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	3.71e-232	39	1457	59	1543	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	2.67e-230	11	1443	33	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999684	CS pos: 23-24. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_62305-t26_1-p1.