CAZyme Information: TRIREDRAFT_61066-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_61066-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	GL985063|CGC4	65108.77	5.7952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985063:294166-296109(-)

Full Sequence      

MQIVSIEDFTRQSFDFLVIGGGTAGLVVASRLAQDGRFTVGVIEAGGPVNGREDVDIPGY
FGKSLGSEIDWKFRSAPLAEVGGKTLMCPRGKALGGSSAINFMTWCRASREDYDAWEVLG
NPGWGWDDLLPYFKKSETFHPPSPAVQAEEDIRYDPDSFGYSGPIHISYTTHIPPRHRLW
SNTLNSLGVKTNSAHAAGSIAGVWTNINNIDPRTMTRSFATNYCALAGSDLHIMTQATVQ
DIVLDKTSDGYVASGVRFIHGNQEYVVSASREVILSAGTIKSPQILELSGVGNPEILSRA
GIAVKVESPMVGENLQEHKAIHAIVEHDPGLENSDDLFLDADFAAAAREQFARDKTGSLA
HVFGHYAFVPLARYIPQDTLDKLCSRVQALTEFSAEKKAILEERLRCTDKRGQIEYIFKL
GAGRLAESGRKLATLYQILQYSFSVGSVHIQPAPSQREDPVIDPGFYQGPTGELDLEVML
ESTRFAREILLAPHMSSIVKQLVHPPASFYGDDEAMRKWIVDHTGMAMHAVGTCALGGHA
GVRGGVVDERLKVLGVESLRVVDASIMPLQIGAHIQATVYAIAEKAADMILQDAARQQ

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_61066-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	593	6e-172	0.9982394366197183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.84e-89	13	598	7	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.67e-81	10	591	2	532	choline dehydrogenase; Validated
274888	Rv0697	4.01e-49	15	591	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.69e-32	81	318	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.10e-30	443	586	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS96342.1|AA3_2	5.83e-309	1	596	1	596
UKZ49614.1|AA3_2	7.06e-279	1	545	1	545
UKZ87414.1|AA3_2	3.77e-274	1	597	1	597
UKZ66990.1|AA3_2	1.58e-268	1	597	1	597
UPK95263.1|AA3_2	3.81e-228	4	598	8	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	4.98e-68	11	593	3	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.57e-67	13	594	5	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	2.73e-57	14	590	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6O9N_A	1.77e-53	11	593	33	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
3Q9T_A	9.48e-51	14	590	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	6.86e-100	1	593	1	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	6.86e-100	1	593	1	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.90e-89	1	593	1	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.52e-81	4	593	30	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	5.40e-71	8	591	41	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998535	0.001509

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_61066-t26_1-p1.