CAZyme Information: TRIREDRAFT_60374-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_60374-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: choline oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		59280.34	6.6016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985062:1391266-1392943(+)

Full Sequence      

MATTDQLPTGAAGQFDYIIVGGGTAGCVIASRLSSYLPHKNILMIEGGPSDVGDDRALIL
KDRFKMQGTELDYAYTSVPQPNVGNSNILHSRAKILGGCSSHNDMVSFRTPEYDAYTWER
LGCTGWSFETFKRLYQQLRVITYPGAHPRDQNQLSKDWILSAHRALGLPLVKDFNKGITS
SSGLTEGAGWTPLSYNPENGWRGSASVSYIHPILRGDEKRPNLTILTNAWVSRVNLQGDT
ATSVNVTTSDGRKHVVCAAAEIILCAGAIDTPRLMLLSGLGPRGRLESVNIPVIKDIPGV
GENLQDHPCTLVQFELHEEVPENTATHSDVLAFLRHKPYNWAGDDGNIPDILLHMWQLND
DMTPAGYERPRHPFIILPVVLRTHARGSVYLKSKDPQEKPAIDFKYFEDADGYDADLLVA
GIKAVRKMAASEPLRSWIKHEAAPGAQVTSDEELNKYARAASQTMFHPACTTKMGDVLND
PKAVVDSRLCVRGINNLRIADAGVFPTMITVNLMLTVLAVGERAAELIAEDAGWQGSKSR
L

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_60374-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	537	4e-88	0.5129449838187702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.51e-117	8	533	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.83e-101	14	528	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.85e-39	384	524	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.77e-26	15	309	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.15e-21	10	521	51	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99666.1|AA3_2	2.12e-240	3	541	2	542
QMW36122.1|AA3_2	2.01e-221	1	541	1	542
QRD92907.1|AA3_2	2.01e-221	1	541	1	542
QMW48182.1|AA3_2	2.01e-221	1	541	1	542
BAE65509.1|AA3_2	2.01e-221	1	541	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.96e-100	14	528	13	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3LJP_A	3.88e-100	14	528	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.88e-100	14	528	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
7AV4_AAA	1.03e-50	4	532	73	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.19e-50	4	532	13	580	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.01e-99	14	528	13	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.93e-65	14	528	1	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	6.96e-63	14	528	4	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P64264|Y1310_MYCBO	6.96e-63	14	528	4	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	6.96e-63	14	528	4	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000003

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_60374-t26_1-p1.