CAZyme Information: TRIREDRAFT_58525-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_58525-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		46278.24	8.2442

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985060:1619955-1621223(-)

Full Sequence      

MHFSSLSLGLLSAAGVVVNALPGLGLGDLLWPLKVPDTVVIDGWRLVDAKTRLYLGDREL
KAALKHLTAQADSWLSQGPWTVTAKTKPPPNGTIHDYSSQAPYWWPNPSTPDGCPYNQRD
GERNPEVDQYQDRVSVGKMFNSTYVLSLAWYYTGEKRYSQHAADILRTWFLDDKTAMNPN
LEHAQIIPCANTGRSIGIIDFSQEYTNVVDAVAILNSGPAPGWTKRDNNKFVDWNKRFLA
WLADSPFGVEEASAQNNHGTFANMQIAALAVFTGNHSLAVQRTRIARGFIDSQITANGSQ
PQELARTRSFHYSNFDLCAHLRMALIARKVGVDLFRYKGPQGQTLFKAVEFLVPAAKGGA
RAWTYPELGFTQYAATDNVRAAAQEGDTVARGAVKGLKAPPGGDIFGLRPAPEQLDSIAT
VG

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_58525-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	82	358	9.5e-104	0.982078853046595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.72e-98	81	361	1	273	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
234727	algL	9.40e-06	256	339	194	277	polysaccharide lyase.
238148	AlgLyase	1.28e-04	256	377	178	288	Alginate Lyase A1-III; enzymatically depolymerizes alginate, a complex copolymer of beta-D-mannuronate and alpha-L-guluronate, by cleaving the beta-(1,4) glycosidic bond.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
OTA06285.1|PL38	1.32e-306	1	422	1	422
QYT05465.1|PL38	1.51e-254	1	422	1	419
UKZ57530.1|PL38	6.16e-254	1	422	1	419
UKZ83240.1|PL38	2.50e-253	1	422	1	419
UKZ91858.1|PL38	1.07e-245	1	422	1	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	3.44e-62	49	368	4	333	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

TRIREDRAFT_58525-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000541	0.999435	CS pos: 20-21. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_58525-t26_1-p1.