CAZyme Information: TRIREDRAFT_58117-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_58117-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: glycoside hydrolase family 89

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	GL985059|CGC5	84668.53	5.1262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985059:940697-943069(+)

Full Sequence      

MRVLKSCVWLLSAVGVAASSYQSPTEGVESLVKRRLPQHVDSFEFVLEPPHGSVVVNDSY
TVSSTKNGKVRIEGTTTSALLSGLHKYLSSEANADIWWFIGSQLDQTPKNLPKLRAPIKG
SSVVPYRYYWNTVTTSYTSAFWTWEDWETQLDWMALRGVNLALAWIGVEKIFIDAFHEIG
LNDEEIDSFISGPAFLAWNHFGNIQGSWGGTLPRSWVDEQFSLQLKILKRMEELGITPIL
PAFPGFVPRNISRVFPDISLSTSPIWSNFGTTLSADIYINPFDPRFAQLQKLFINKQQEL
YGNVTNFWTLDQFNENRPLSGDLDYLRNVSHNTWAALKAADPEAVWVMQAWLFSSDSSFW
TNDRVEALLGGVPVNQDMLLLDLFAESAPQWQRTDSFYGKPWIWCELHNYGGNMGLYGQI
ENVTINSMDAVRNSDSIVGFGLTMEGQEGNEIMYDLLLDQAWSPKPIDTDTYFHDWVSAR
YGAKNVKGLYKGWEMLRPTVFNNTNLTVNAVQKSILELTPSISGLLGRTGRHGTTIMYDP
AVMVEAWSELFKAGLQDLTLFNNPSYQYDLVDWTRQVLVNSFEDHYKDLVDAYNKSSSPT
VIRTRGAKLVTLLKTLDAVLATNKNFQLTPWIDRARASSPSSANFFEFNARNQITLWGPQ
GQIEDYASKQWAGLVGTYYAERWQQFVDYLATTKPANYNQTAFHEKLLVWETKWGQQTST
RKVNAGASDIRSVLDVALKSWSDVFQL

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_58117-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	66	729	1.8e-208	0.9834087481146304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	127	464	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	8.41e-89	472	720	1	244	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	8.74e-25	26	112	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ51971.1|GH89	0.0	1	747	1	748
QYS99001.1|GH89	0.0	1	747	1	747
UKZ77799.1|GH89	0.0	1	747	1	730
UKZ63441.1|GH89	0.0	1	747	1	751
UKZ88341.1|GH89	0.0	1	747	1	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	4.47e-143	28	690	9	659	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.23e-106	57	688	201	822	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.46e-106	57	688	209	830	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.46e-105	57	688	224	845	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	9.35e-145	8	690	12	682	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	5.91e-131	24	719	40	782	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000396	0.999589	CS pos: 18-19. Pr: 0.9737

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_58117-t26_1-p1.