CAZyme Information: TRIREDRAFT_57857-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_57857-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: glycoside hydrolase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894	GL985059|CGC8	100576.51	5.3289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985059:877954-880802(-)

Full Sequence      

MARHSIQLDKGWTFRQHQGSSPEWLPVEKVPTQVHMDLLANKQIPDPFVDLNERAVQWIG
YKDWEYQVTFTPEAAQVEDATRDLVFNGLDTFATVYLNEAKILEAENMFVSYRVNVTDRI
KASSENTLRIVFHSAIVRGEELIKEHPEHNFLVRQTERSRVPVRKAQYNWGWDWGPILMT
AGPWKPVALETYVARIDDVWAQSDVSQDLKTVSGIIFARVAGRPSQDDQVSLTLSLDGKA
VFQQTVDVASAKDGLIKVPFKLEDPKLWYPRGYGSQPRYQLNADLARKASDASQIDSLSK
LVGFRRAELVQEPDAFGKSFYFRINNVDVFAGGSCWIPADSYLAGVPPERYHAWAKLIAD
GNQVMLRVWGGGVYEEDALIEACDELGILVFHDFQFACASYPAYPSYLENLEVEARQQIR
RLRTHPSVIIWAGNNEDYQVQERYKLDYEFENKDPESWLKSSFPARYIYEHFLPKLVEEE
DPGKIYHPSSPWGDGKPTADPTVGDIHQWNIWHGTMNKYQEAVNMGGRFVSEFGMEAYPH
LSTTRRMASDPAQLYPGSMVLDAHNKAIGHERRMMSYVVDNFRPRHDLGGYTHLTQVVQS
ETMRAAYKAWRRQWGKPGARRCGGALVWQLNDCWPTMSWAVVDYRLVKKPAYYAIARALR
RVDVGVCRTWHDWTQTGAWVDENSGLVTGQVDHTLAAREGTFDVWVVSSDTQPVALDLVV
RFISVRTGRDVVDPILHSRVVAAANSATDILQGKTLPPSIPNPEDITKPFPLAEYDPYVV
HATITDAATGTVIAADTAWPEPIKYLDLSDRGIAFEVSSAGDEVVVSAEKPVKGFVFEEV
EGLELSDNGFDVVPGEKQLVKVGGALKAGELLWTCIGADSASLKIEASSSLAPR

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	677	8e-83	0.6316489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.90e-69	44	655	47	626	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	2.70e-14	700	805	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	6.65e-08	194	305	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	5.25e-05	812	862	3	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS99024.1|GH2	0.0	1	893	1	893
UKZ77816.1|GH2	0.0	1	893	1	893
UKZ51991.1|GH2	0.0	1	893	1	893
UKZ88363.1|GH2	0.0	1	893	1	895
QLI66193.1|GH2	0.0	6	886	6	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	7.53e-134	6	666	27	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	9.02e-115	8	872	11	827	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	9.45e-115	8	872	13	829	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	9.68e-115	8	872	13	829	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.51e-114	8	872	11	827	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NW36|MANBB_ASPFN	1.31e-289	8	870	9	834	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	1.36e-289	8	870	9	835	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	1.36e-289	8	870	9	835	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	5.29e-289	8	870	9	834	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B0YBU9|MANBB_ASPFC	5.47e-289	8	870	9	835	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_57857-t26_1-p1.