CAZyme Information: TRIREDRAFT_56894-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_56894-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	GL985058|CGC9	89114.54	6.7556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:973573-976793(+)

Full Sequence      

MHEVGNPQCPSLCVGNGRHEWTAYSSMESLSLCDQPMLFDFAIHVRVDDPESTLRFRACT
AANMTERQVLNSTHHGSQHSETHMPGDAHLSSADIARWSPGEAESGLNAVVAFDSLRHHL
GEATDSGENIILFASVHNTVLGLYVGASVDAASAVSALAPGLVDSPYTTGASRSLAQICG
QGRNSEHTVGVAISFENDLAAVQSCVASWSRAECAPTDDSSEISTLTDLNIWTRSDLPGR
PLTRHSHTHLHPRGECKAIKVVPGDSCASLASKCGVSGANFERYNSYDKRLCSKLAVGKP
VCCSPGKLPDLRPKPKPSGECATYTVKSSDTCADIAASNGLETTDVVEFNRKTWGWNGCK
SLLVGQSICLSKGTPPLPAPVPNAVCGPTKPGTKKPPAGVALATLNPCPLNACCNIWGSC
GTTKEFCTISRSGTGNPGTSRPGENGCISNCGMGIVNNKEAPDSFKKVTYYESWNLDRSC
MHMDVRTVGDLGQGYTHLHFAFVNITKDLKVSVQDPRGQFEHFKGLSGIKRIAAFGGWSF
SVGVDTYATLRQAIKPEHREFFATQVVDFLKQHKLDGVDFDWEYPGATDLPIPAGSPEDP
ANYLRFLQLLRKKLPAEMSLSIAAPASFWYLKAFPIADIAKTVDYIVYMTYDLHGQWDFN
SRWASDGCPKGSCLRSHVNMTETLNALAMITKAGVEARQVVVGVASYGRSFEMNDPKCKG
PMCTFTGPQSLAAPGGCTNSSGYISNAEILDIMEDRKSYPVQAWYDEKTDSDYLIYNREY
SKTQWVAYMSKSVKEARIKKYQALNFGGISNWAIDLEEWW

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	467	815	2.4e-55	0.9222972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	0.0	466	817	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.15e-65	466	816	1	333	Glyco_18 domain.
395573	Glyco_hydro_18	3.26e-57	466	815	1	305	Glycosyl hydrolases family 18.
225862	ChiA	8.35e-47	456	818	27	424	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119365	GH18_chitinase	2.51e-45	468	733	2	301	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95779.1|CBM18|CBM50|GH18	0.0	9	820	33	841
UKZ76900.1|CBM18|CBM50|GH18	1.77e-239	8	818	44	882
EGX48217.1|CBM18|CBM50|GH18	4.82e-239	9	817	35	841
UKZ59558.1|CBM18|CBM50|GH18	8.61e-239	9	819	37	841
QGA13088.1|CBM18|CBM50|GH18	2.95e-234	9	817	60	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	1.37e-32	468	818	7	351	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	1.51e-31	468	818	7	351	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
3WL1_A	5.02e-28	496	818	37	360	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3W4R_A	9.69e-28	456	818	16	378	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
3WKZ_A	1.23e-27	496	818	37	360	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	6.94e-102	277	819	208	717	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q9BZP6|CHIA_HUMAN	1.89e-25	496	818	52	366	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	3.25e-25	496	818	52	366	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q91Z98|CHIL4_MOUSE	3.33e-25	452	818	9	366	Chitinase-like protein 4 OS=Mus musculus OX=10090 GN=Chil4 PE=1 SV=2
sp|P36362|CHIT_MANSE	6.56e-25	496	818	53	376	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_56894-t26_1-p1.