CAZyme Information: TRIREDRAFT_56418-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_56418-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: glycoside hydrolase family 55

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	GL985058|CGC12	82611.84	6.1297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:158433-160974(+)

Full Sequence      

MRFASLFLGLAAVVAGDPLPPAQDVEARHSSGYWYEKIQHNGISPFIADGKNWKVFRNVK
TDFGAKGDGITDDWAAIQAAFDYANATEKRSSGAWGTTGAPAVVYIPAGTYRLSKPLQSY
VDTVVMGDPIHRPVLQASPDFTDPFLYLGYDPNYDSTINFYIGLKNVVLDSTKVPLTHNI
TLLNWAVSQAVQLTNVLFNMPNGGVAHTGLSMPQGGSPLMINDVVFQGGSVGIRMNEQQY
HFKGITFKNQDIGLKLDKLFEGTGQGLHFESCKVGIETTNNNTGFFALIDSTAKNVDILW
NAAASPTAQGSMVLENVQVDWSTVTAGGKSVLKGSVRPGQSWIWGNVYGPVKGQRAEGKF
FPASRPLALVDITGSYHAVPPPTFQEYSVDQVINVKSVHGLPVAGDGVTDDTKNLQKIIN
KAAGKSVLFFPHGTYLVSDTLVVPPGSRFHGEVWSEISATGDKFKNANKPVAMVQVGKPG
QIGVAQFVDMLFTVADILPGCKLVEVNMAGLKAGDVGFFNTHFRIGGARGSKVQTNCDDP
ATCKAARLCAHLTTSSSSYWENSWCWSADHDLDDDFGANPSTAGGFLVESTRATWMLGIG
SEHNSLYQINVYKARNVFLGFQQSETPYWQGNNSGLLTPLPWTNSLLASDPDFSWCAADD
AQCRMAIFQYIHDSSNVNVYGGGYWVFFNGINRDGCSAECQQNAVIYADNQQLYSYGVST
HNVRTMVLESERGKAVAEVVDTANAGGWQSHGGVMAAYLGQSGF

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_56418-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	24	748	5.2e-201	0.9824324324324324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.88e-51	56	277	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	5.06e-05	393	442	2	51	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	8.24e-05	61	184	86	199	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ54260.1|GH55	0.0	1	764	1	763
QYT01944.1|GH55	0.0	1	764	1	766
UKZ80036.1|GH55	0.0	1	764	1	756
UKZ93151.1|GH55	0.0	1	764	1	766
QBB79303.1|GH55	0.0	1	764	1	766

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	4.30e-121	21	720	14	724	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	5.92e-110	31	744	4	744	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
7CHU_A	3.37e-07	28	117	43	128	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	6.29e-118	6	733	17	855	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	2.01e-112	1	735	1	768	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.24e-95	5	758	9	760	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999739	CS pos: 16-17. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_56418-t26_1-p1.