CAZyme Information: TRIREDRAFT_56328-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_56328-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: glycosyltransferase family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506	GL985058|CGC11	56353.34	4.4499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:99282-100802(+)

Full Sequence      

MLVTRCHSPISHRGITVLFLIATVFLLTLLAKQEHNKGTRQYELPFGIGLAISAQDGLRA
VKQCSSELDYLRRKEYGLTRNVVYRKRCVRGVYSEDAGLRDSVTEVDSPLLGSRADILDL
DNECKSISSPHSPVEAQSCEPITLQVSKPFPTADLSNVMFGVATTLSRLQDSIPQFSHWL
SGTGALFLAIVVDDSVTDDDLDALESMYEAHDISLTTIRPWNCSFDVNEQHFAILHDLID
YSTHETQWIAIIDDDTFFPSPYSISQLLASHNASEPTYIGGLSESQGAVAFFGHMAYGGA
GVFMSMPLVEQLDSHVEDCLAQSITRQGDGLLNDCIRNYTQTELIAIPGLHQLDMRGDLS
GFYESGTFPLSLHHWKSWHQAPVDKMAKIANYCGDCFLQRWKFGGDSILANGYSISVYQD
GITQAELDLMEGTWEEAMGYEATMGKMREKAGDGKKKSYRLIDAEEVDGSLRQIFVLHGA
SDMDLDGEQEAMDEVVELWWDWPRGD

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_56328-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.30e-15	245	374	210	341	hypothetical protein; Provisional
398362	DUF604	7.22e-09	291	374	4	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	1.65e-07	222	378	59	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ80054.1|GT31	2.03e-316	1	504	2	505
QYT01920.1|GT31	6.39e-306	1	504	1	504
UKZ93174.1|GT31	4.16e-298	1	506	1	506
UKZ66083.1|GT31	3.99e-289	1	506	1	506
UKZ54280.1|GT31	3.66e-266	1	504	2	487

PDB Hits     

TRIREDRAFT_56328-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TRIREDRAFT_56328-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.799011	0.200994

TMHMM  Annotations     

Start	End
9	31