CAZyme Information: TRIREDRAFT_56203-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_56203-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: glycosyltransferase family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		47250.33	9.9498

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985058:1847191-1848564(+)

Full Sequence      

MKLIPYHESRPLRSLIAVFAAWKGFLLAIALGTTVSQDYDTSTSLFFEHAYGSSANASIL
ATRLTRWDALYFMQAARHGYVYEQQWAFGAALPLSVRGIMWLLRPLTHLAGDAALEPVVA
IVLTNSAHLAAVLALHRLTLVLFGNKRLAYVAAVLHILSPAGLFLSAPYAESPFACLSFT
GSLLFAAGLRPSATVGMRMLAFVGAGISFGLATSFRSNGLLNGLLFAVEAVKCLSGFLRH
PSLSRLALLASLVIGGLGIASGSVVPQAVAWSRYCNIDPADGMEPRPWCSRLIPSIFTFV
QSHYWNNGFLKYWTPNQLPLFLLASPVLTLLISSGLQVTRSLGQGLDRATPVVEEPYHTF
VLTLAVIQTLVAALAITNFHVQIITRLSSGYPVWYWWIANSLRDGKSRKTGSVAVLFMVM
YAGIQGGLFASFLPPA

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_56203-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	436	5.9e-112	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	7.40e-41	26	436	16	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	6.93e-18	66	436	76	407	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53459.1|GT76	2.57e-247	1	436	1	437
QYT02819.1|GT76	7.00e-245	1	436	1	437
UKZ62611.1|GT76	4.69e-221	7	436	6	433
UKZ87563.1|GT76	3.14e-219	7	436	6	433
QLI68133.1|GT76	8.23e-161	6	436	4	429

PDB Hits     

TRIREDRAFT_56203-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.82e-158	1	436	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	8.65e-122	8	436	15	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.54e-83	3	436	21	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.63e-82	7	436	14	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.91e-56	14	436	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.937777	0.062246

TMHMM  Annotations     

Start	End
12	34
113	135
148	170
190	212
219	238
243	265
320	339
359	381
411	433