CAZyme Information: TRIREDRAFT_55802-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_55802-t26_1-p1
• CAZy Family: GH27
• CAZyme Description: glycoside hydrolase family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		51332.72	4.5751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985057:1326131-1327622(+)

Full Sequence      

MRFVKSLNIATAGSSVMTAPASLDVKSLSSVRDVAATLAFDTMSYYKGNLSSADSINMGD
LQDPYYWWTAGALWGAMLDYYHLTGDPSYNDVVIQALLAPTNLGTENAYMPAEHAFEEGN
DDLFFWGSAAIAAAERNFPQPDRSLPSWLELGANVFDQLMSRWNTQHCGGGLLWQIYESN
PNGLTYKNSVSNGGFFQIAARMARATGNDTYLEWAEKVWDWSMDVGFIDADLYHVYDGSG
IDTNCTKTNPASFTYTSGIYLHGAAVMANYTGKPEWKERAEKLLDGAVWFFHPPNVTATI
MYEGACETVERCNADQTTFKGYLARYMWQATQMVPSLRSKVESLLVGSAEAAAGTCTGGS
TGRACGQKWYVGQFDGIPGFGQQMCALEAIQGLLISEAAPPLEAKDIKVVRDANWSAAGA
GKDLPTRAVQTSSTTKRGNAGEAQPTGNAAAGRVMDVGLGSLMVMGLGLVVVVVAV

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_55802-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	399	2.4e-96	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.99e-161	30	387	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.45e-09	65	327	44	274	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ47137.1|GH76	1.82e-268	1	470	1	464
UKZ85257.1|GH76	3.00e-268	1	469	1	467
QYS93772.1|GH76	2.86e-265	1	469	1	463
UKZ60087.1|GH76	1.44e-262	1	469	1	470
UKZ85258.1|GH76	2.72e-249	43	469	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	6.33e-94	31	401	36	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
6SHD_A	1.89e-11	33	329	56	322	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.30e-10	33	329	57	323	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	4.39e-10	33	329	57	323	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	5.14e-106	23	406	24	397	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	2.96e-104	23	404	21	392	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	4.65e-102	22	414	21	396	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	9.66e-101	22	404	23	397	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	1.85e-96	23	401	29	399	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.976753	0.023291

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_55802-t26_1-p1.