CAZyme Information: TRIREDRAFT_55005.P97

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_55005.P97
• CAZy Family: GH24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		58424.39	9.3802

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985056:1112613-1114481(+)

Full Sequence      

MWRRTYLLLVLVRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSENPIRSVF
PLWPVYGLPMLLLQWLWVGNGQDGQVPPIAVFWTLRFFMFLLSFVLEYWALQEQITSTRH
RPIAVLLVASSYVTWTFQTHTFSNSVETLAVLWSLVLIGRITSPHSSILSSVVLGMVVVF
GTFNRITFPAFLLIPGLWLVPYYWKKPLSLAALVLAALVTACTAIAVDTAFYTPGTVTWS
DLITHPVITPLNNLVYNSSPENLALHGLHPWYQHLVANLPQLIGPAVALMFLRPYVSLRL
WSAISGIAALSFVQHQEARFLLPAVPLILSSLKLPRSQTLRRLWIAIWVVFNLLLGVLMG
TYHQGGIIPGQVFLSKQPDATTAVWWKTYSPPIWLLNGKNEVLTTKDVMGMKGEALLDLL
TELATCDTPADRRNTEYLKEKNGTYLIAPASATWLDPYLPNKGLEGLRFREVWRYRKHVN
LDDLDFGDDGVWNTLSRVIGRRGLVAWRVTKSCEL

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	395	6.8e-78	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	2.82e-46	5	394	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ86010.1|GT22	0.0	1	515	1	521
UKZ54961.1|GT22	2.67e-313	1	515	1	482
UNI14407.1|GT22	3.08e-311	1	513	1	515
QYT01138.1|GT22	7.88e-311	37	515	34	512
CZS72668.1|GT22	6.09e-307	1	513	1	515

PDB Hits     

TRIREDRAFT_55005.P97 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	1.08e-307	1	513	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	9.60e-177	1	507	1	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	8.91e-174	1	512	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	3.13e-167	1	507	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	2.03e-98	10	485	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999654	CS pos: 17-18. Pr: 0.9500

TMHMM  Annotations     

Start	End
60	79
89	111
123	142
181	203
210	232
270	292
343	365