CAZyme Information: TRIREDRAFT_54129-t26_1-p1

Basic Information

• Species: Trichoderma reesei
• Lineage: Ascomycota; Sordariomycetes; ; Hypocreaceae; Trichoderma; Trichoderma reesei
• CAZyme ID: TRIREDRAFT_54129-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	GL985056|CGC9	36157.79	4.5350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TreeseiQM6a	9138	431241	7	9131

• Gene Location: location=GL985056:2966890-2968061(-)

Full Sequence      

MVISVRLLLTVAQLGLIAGSAYAEKEYIWPAKTDLLESMLYEQQGFGSANSPATFIVPCD
KVTFGKGRNGAAEWLRTAYHDMATADVEAGTGGIDASIGFEVNRDENVGIGFNETLMNLI
AFLTPRSSMADLIALGALFAANGCSNGSVEIPFRAGRVDATGPGPSGVPRPEQPLDEHIS
SFQKQGFTPQEMIGLVACGHTLGGVHGVDFPEIVDVATDDNTQTFDTTNTGFTAFDNTVA
VQYVANNTQNPLAFGHNVTTRSDARIFSSDGGEEIGQMASSPAYFFKRCQTLLERMINTV
PRGVTLTDPIQPIPVKPLRLFATINSNGTMTMSGYIRV

Enzyme Prediction     

No EC number prediction in TRIREDRAFT_54129-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	66	290	2.9e-27	0.8862745098039215

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	8.95e-108	29	298	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	1.08e-28	71	298	18	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.13e-17	64	206	9	155	Peroxidase.
173826	ligninase	6.00e-15	64	227	29	200	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	1.49e-14	75	206	34	168	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT03617.1|AA2	6.30e-113	28	338	25	341
UKZ86986.1|AA0	7.53e-112	26	338	23	342
QGI68923.1|AA0	1.95e-74	23	338	16	326
VBB76056.1|AA0	2.72e-71	12	338	12	332
QKD59397.1|AA0	1.39e-70	23	338	16	326

PDB Hits     

TRIREDRAFT_54129-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.22e-63	29	338	23	330	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	6.37e-12	68	206	27	164	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q8GY91|APX6_ARATH	3.37e-10	62	217	109	260	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q6ZJJ1|APX4_ORYSJ	5.81e-06	75	206	35	166	Probable L-ascorbate peroxidase 4, peroxisomal OS=Oryza sativa subsp. japonica OX=39947 GN=APX4 PE=2 SV=1
sp|P0C0V3|CCPR_EMENI	9.87e-06	75	206	117	251	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999765	CS pos: 23-24. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in TRIREDRAFT_54129-t26_1-p1.